RetrogeneDB ID:
retro_ecab_1096
Organism:
Horse ( Equus_caballus )
Location:
X:5395748-5396693 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.96 %
Coverage:
70.38 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
AZIN1
Parental gene aliases:
No gene alias available
Parental gene description:
antizyme inhibitor 1 [Source:HGNC Symbol;Acc:16432]

Genomic region (view in browser)





>retro_ecab_1096
GACAGTGAAGTTGAATTGAAGAAAATTGCACGTAATCACCCAAATGCCAAGGTCTTACTA
CGTTTTGCAACAGAAGATAATATTGGAGATGAAGAGGGTAACGTGAAGTTTGGCACTACC
CCGAAGAACTGTAGGCATCTCTTGGAATGTGCTAAGGAACTTGGTGTCCAAATTATTGGG
GTTAAATTTCATGTTTCAAGTGCTTGCAAAGAATCTCAAGCACATGTACATGCTCTGTCT
GATGCTCGATGTATGTTTGACATGGCTGGAGAATTTGGCCTCACAATGAACATGTTAGAC
ATTGGTGGAGGCTTCACAGGAACTGCATTTCAGTTGGAAGAGGTTAATCATGTTATCAGC
CCTGTGTTGGATGTCTACTTTCCTGAAGGATCTGGCATTAAGATAATTTCAGAACCTGGA
AGCTACTATGTGTCTTCTGCATTTACACTTGCAGTTAATATCATTGCGAAGAAAGTTGTT
GAAAATGATAAATTATCCTGTGGAGTAGAAAAAACCAGAAGTGATGAGCCAGCCTTCATG
TATTTCATGAACGGTGGTGTTTATGGTTCTTTTGCAAGTAAACTGTTTGAGGACTTAAAT
ACCTTTCCAGAGGTTCCCAAGAAATACAAGCAAGATGAGCCTCTGTTTACAAGCAGCCTT
TGGGGTCCATCCTGTGATGAGCTTGATCAAATTATGGAAAACTGTCTTCTTCCTGAGCTG
AATGAGGGAGATTGGCTTATCTTTGATAACATGGGAGCAGATTCTTTCCATGACCCATCT
GCTTTTAATGATTTTCAGAGGCCAGCTATTTATTACATGATGTCATTTAGTAATTGGTCT
GAGATGCAAGATGCTGGGGTTACTTCAGACACAATGATGAAGAACTTCTTCTTTGTGCCT
TCTTGCATTCCGCTGAGCCAAGAAGACAGCTTTTCCACTGAAGCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.58
SRP021940_cerebellum 0.95
SRP021940_embryo 0.24
SRP021940_placental_villous 1.52
SRP021940_synovial_membrane 0.49
SRP021940_testis 0.89

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DNEVELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQAYVHALSDARCVFDMAGEFGFTMNMLD
D.EVELKKIARNHPNAKVLL..ATEDNIG.EEGN.KFGTT.KNCRHLLECAKEL.VQIIGVKFHVSSACKESQA.VHALSDARC.FDMAGEFG.TMNMLD
Retrocopy
DSEVELKKIARNHPNAKVLLRFATEDNIGDEEGNVKFGTTPKNCRHLLECAKELGVQIIGVKFHVSSACKESQAHVHALSDARCMFDMAGEFGLTMNMLD


Parental protein
IGGGFTGTEFQLEEVNHVISPLLDIYFPEESGIKIISEPGSYYVSSAFTLAVNIVAKKVVENDKLCSGVEKTGSDEPAFMYYMNDGVYG-FASKLSEDLN
IGGGFTGT.FQLEEVNHVISP.LD.YFPE.SGIKIISEPGSYYVSSAFTLAVNI.AKKVVENDKL..GVEKT.SDEPAFMY.MN.GVYG.FASKL.EDLN
Retrocopy
IGGGFTGTAFQLEEVNHVISPVLDVYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENDKLSCGVEKTRSDEPAFMYFMNGGVYGSFASKLFEDLN


Parental protein
TFPEVHKAKKYKEDEPLFTSSLWGPSCDELDQIVENCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAVYYMMSFSDWYEMQDAGITSDTMMKNYFF
TFPEV...KKYK.DEPLFTSSLWGPSCDELDQI.ENCLLPELN.GDWLIFDNMGADSFH.PSAFNDFQRPA.YYMMSFS.W.EMQDAG.TSDTMMKN.FF
Retrocopy
TFPEV--PKKYKQDEPLFTSSLWGPSCDELDQIMENCLLPELNEGDWLIFDNMGADSFHDPSAFNDFQRPAIYYMMSFSNWSEMQDAGVTSDTMMKNFFF


Parental protein
VPSCIQLSQEDSFSTEA
VPSCI.LSQEDSFSTEA
Retrocopy
VPSCIPLSQEDSFSTEA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide