RetrogeneDB ID:
retro_ecab_1097
Organism:
Horse ( Equus_caballus )
Location:
X:6128044-6128473 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.39 %
Coverage:
73.74 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
THOC7
Parental gene aliases:
No gene alias available
Parental gene description:
THO complex 7 homolog (Drosophila) [Source:HGNC Symbol;Acc:29874]

Genomic region (view in browser)





>retro_ecab_1097
AGAAAGCACCTCTTAATTGGTGGGGACGGTCAGAGAATTAATCAGCTAGTGAAGAATTTC
ATTAAATGGTGCAACTCTGGATCCCAGGAGGAGGGATATGGCTGGTGCCAATGTACGCTG
AGCACAATGTCACAATGCGGCTTTTCAATCGGCAAAACCTCACTGGTACATGATCCAAAT
CCCAGAGAACTGAAGAATTATGAAAAAGTGTGCTAAGATATAGAATGTAGCATAGCTGCA
GAACATGAAAGGAAAATGCTGAAGGCAAAATGCAGATTCTCTCAAGCAAAATGAGCATGG
AAAAAATAGTCAGGAACCCAATGCTTTTCTGAAAGTATTCCAGCATCATCCAAACAGGCA
TGAAGCAGAAAAGAACAACAGGCTCTGGGAAAAGACTTAGAGCCTTTTTCAAACATACTA
AAGAAAATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.59

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHE-KIAECKKQILQA
RK.LLI.GDG.....RIN.LVK.FIKWCNSGSQEEGY...Q..LST.SQC.FS.GKT.LV.D.N.RE..NYEK....IECSIA..HE.K....K....QA
Retrocopy
RKHLLIGGDG----QRINQLVKNFIKWCNSGSQEEGYGWCQCTLSTMSQCGFSIGKTSLVHDPNPRELKNYEKVC*DIECSIAAEHERKMLKAKCRFSQA


Parental protein
K-RIRKNRQEYDALAKVIQHHPDRHE-TLKELEALGKELEHLSHIKESV
K....KN.QE..A..KV.QHHP.RHE...KE..ALGK.LE..S.I....
Retrocopy
K\EHGKNSQEPNAFLKVFQHHPNRHE/SRKEQQALGKDLEPFSNILKKI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide