RetrogeneDB ID:
retro_ecab_110
Organism:
Horse ( Equus_caballus )
Location:
7:13734100-13735303 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.12 %
Coverage:
77.34 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
DDI2
Parental gene aliases:
No gene alias available
Parental gene description:
DNA-damage inducible 1 homolog 2 (S. cerevisiae) [Source:HGNC Symbol;Acc:24578]

Genomic region (view in browser)





>retro_ecab_110
ATGCTGGTCACTGTGTACTGCGTGCGGAGGGACCTCTCCGAAGTAACCTTCTCCCTCCAG
GTCAGCCCTGACTTCGAGCTCCACAACTTTCGGGTCCTCTGTGAGCTTGAGTCCGGTGTT
CCTGCTGAAGAGACCCAGATCATCTACATGGAGCGACTCCTCACTGACGACCACTGTTCC
CTAGGCTCCTATGGCCTCAAAGACGGCGATGTCGTTGTTTTACTTCAGAAGGAGAATGTG
GGACCTTGGCATCCCGGACGGACATCAAGCCTCCCTCGAATTGATTTCAGTGGGATAGCC
GAGCCTGGGACATCCAGCTCCCGGCAGCAGCACCATCAGCAGCAGCGTGCACCATCAGCC
CAGAAGGCCCATGGCCTGGACTCTGGAGAGAAGATGAGGTCTGCTCAAGGTCTGGACAGC
CCCGCCTTGATCCGAAGCATGCTGCTGTCCAATCCCCATGATCTGTCCCTGCTGAAGGAG
CGCAACCCCACCTTGGCGGAAGCCCTGCTCAGCGGAAACCTTGAGACGTTTTCTCAGGTC
CTGATGGAGCAGCAAAGGGAAAGGGCCCTGAGAGAGCAAGAGAGGCTTCGCCTCTGTTCA
GCTGATCCATTTGATTTGGAAGCTCAGGCCAAAATAGAAGAAGAAATCCGGCAGCAGAAC
ATTGAGGAAAACATGAACATAGCAATGGAAGAGGCTCCAGAGAGTTTCGGACAAGTGGCC
ATGCTCTATATCAACTGCAAAGTGAACGGACATCCTTTGAAGGCTTTTGTTGACTCAGGA
GCCCAAATGACCATTATGAGCCAAGCTTGTGCGGAGAGATGTAATATAATACGGCTGGTT
GACCGACGGTGGGCTGGGATTGCTAAAGGAGTAGGCATGCAGAGAATTATTGGCCGAATT
CATCTGGCTCAGATTCAAATCGAAGGTGATTTCTTACAATGCTCTTTCTCTATACTCGAG
GAGCAGCCCATGGACATGCTTCTAGGGCTAGATATGCTCAGGAGACATCAGTGTTCCATT
GACTTGAAGAAAAACGTGCTGGTGATCGGCACCACTGGCACACAGACTCACTTTCTTCCT
GAGGGAGAGTTACCTCCATGTGCTAAGCTGGTAAGTGGTGCTGGGCAAGAAGAGTCTTCA
AACAAGGAAGCAGCAAATACTACTAAACATTCAGTCATGGATTCAGGAAGAAAAAAGCAT
TGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.19
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 1.17
SRP021940_testis 150.89

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RQRQPAGVQQSHSSPGEIASSPQGLDNPALLRDMLLANPHELSLLKERNPPLADALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIE
.QR.P..........GE...S.QGLD.PAL.R.MLL.NPH.LSLLKERNP.LA.ALLSG.LE.FS.VL.EQQ..RA.REQER.RL.SADPFDLEAQAKIE
Retrocopy
QQRAPSAQKAHGLDSGEKMRSAQGLDSPALIRSMLLSNPHDLSLLKERNPTLAEALLSGNLETFSQVLMEQQRERALREQERLRLCSADPFDLEAQAKIE


Parental protein
EDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLA
E.IRQQNIEENM.IAMEEAPESFGQV.MLYINCKVNGHP.KAFVDSGAQMTIMSQACAERCNI.RLVDRRWAGIAKGVG.Q.IIGR.HLAQ.QIEGDFL.
Retrocopy
EEIRQQNIEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIIRLVDRRWAGIAKGVGMQRIIGRIHLAQIQIEGDFLQ


Parental protein
CSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYGAGREDVRPEEFAD
CSFSILEEQPMDMLLGLDML.RHQCSIDLKKNVLVIGTTG.QT.FLPEGELP.CA.L..GAG.E.....E.A.
Retrocopy
CSFSILEEQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTHFLPEGELPPCAKLVSGAGQEESSNKEAAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide