RetrogeneDB ID:
retro_ecab_1104
Organism:
Horse ( Equus_caballus )
Location:
X:29280052-29280500 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.79 %
Coverage:
99.34 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
ARPC5
Parental gene aliases:
No gene alias available
Parental gene description:
actin related protein 2/3 complex, subunit 5, 16kDa [Source:HGNC Symbol;Acc:708]

Genomic region (view in browser)





>retro_ecab_1104
ATGTCGAAGAACACGGTGTCGTCAGCCCGGTTCCGGAAGGTGGATGTGGATGAGTATGAC
GAGAACAAGTTCGTGGACGAGGAAGACGGGGGCGACGGGCAGGCCGGGCCGACGAGGGCG
AGGTGGACTCCTGCCTGCGGCAAGGAAACACGATGGCTGCCCTACAGGCAGCTCTGAAAA
ACCCCCCATCAACACCAAGAGTCAGGCGGTGAAGGATCGAGCAGGCAGCATTGTCTTGAA
GGTACTCATCTCTTTTAAAGCTAATGATATTGAAAAGGCAGTTCAATCCCTGGACAAGAA
TGGTGTGGATCACCTCATGAAGTATATTTATAAAGGCTTTGAGAGCCCCTCTGACAATAG
CAGTGCTGTGTTATTGCAGTGGCATAAAAAGGCACTTGCTGCCGGAGGAGTAGGGTCCGT
TGTTCGAGTCTTGACTGCGAGGAAAACC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.81
SRP021940_cerebellum 1.49
SRP021940_embryo 2.06
SRP021940_placental_villous 4.78
SRP021940_synovial_membrane 3.59
SRP021940_testis 0.89

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGP-DEGEVDSRLRQYPCPRDPRAALKN-PPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSL
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGP.DEGEVDS.LRQ........AALKN.PPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSL
Retrocopy
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGP/DEGEVDSCLRQGNTMAALQAALKN/PPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSL


Parental protein
DKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKT
DKNGVD.LMKYIYKGFESPSDNSSAVLLQWH.KALAAGGVGS.VRVLTARKT
Retrocopy
DKNGVDHLMKYIYKGFESPSDNSSAVLLQWHKKALAAGGVGSVVRVLTARKT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide