RetrogeneDB ID:
retro_ecab_1105
Organism:
Horse ( Equus_caballus )
Location:
X:38172227-38172979 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
92.91 %
Coverage:
85.67 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS2
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S2 [Source:HGNC Symbol;Acc:10404]

Genomic region (view in browser)





>retro_ecab_1105
GGCCGGGGTCACGGCCGCAGAGCTCGCGGAGCAAGGCCGAGGACAAGGAGTGGATCCCCG
TCACCAAGCTGGGTCACCTGGTCAAAGACATGAAGATCAAGTCCCTGGAGGAATCTACCT
TTTCTCCCTGCCCATCAAGGAGTCTGAGATCATTGACTCTTTCCTGGGGGCATCTCTCAA
GGAGGAGGTTTTGAAGATTATGCCGGTGCAAAAGCACACCCGTGCTGGCCAGCGGACCAG
GTTCAAGGCATTTGTTGCCATCGGGGATTACAATGGACATGTCGGTCTGGGTGTGAAGTG
CTCCAAGGAGGTAGCCACTGCCATCCGTGGGGGCATCATCCTTGCCAAACTCTCCATTAT
TCCCGTGCGACGAGGCTACTGGGGGAACAAGATCGGCAAGCCCCCATACTGCTCCTTACA
AGGTGACAGGTCGCTGTGGCTCTGTGCTGGTGTGCCTCATCCCTGCCCCCAGGGGCAGTG
GCATTGTGTCAGCCCCTGTGCCCAAGAAGCTCTTGATGATGGCTGGTATTGACAACTGCT
ACACCTCAGCCAGGGGCTGTACTGCCACCCTTGGCAACTTTGCCAAGGCCACCTTTGATG
CCATCTCTAAGACCTACAGCTATCTCACCCCCGACCCCTGGAAAGAGACCGTGTTCACCA
AGTCTCCCTATCAGGAGTTCACTGACCATCTTGTAAAGAACCACACCAGAGTCTCCGTGC
AGAGGACCCAGGCTCCAGCTGTGGCTACCACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.81
SRP021940_cerebellum 0.3
SRP021940_embryo 1.17
SRP021940_placental_villous 0.72
SRP021940_synovial_membrane 1.09
SRP021940_testis 0.65

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GRGRGRGARGG-KAEDKEWIPVTKLGRLVKDMKIKSLEE-IYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLG
GRG.GR.ARG..KAEDKEWIPVTKLG.LVKDMKIKSLEE.IYLFSLPIKESEIID.FLGASLK.EVLKIMPVQK.TRAGQRTRFKAFVAIGDYNGHVGLG
Retrocopy
GRGHGRRARGA/KAEDKEWIPVTKLGHLVKDMKIKSLEE/IYLFSLPIKESEIIDSFLGASLKEEVLKIMPVQKHTRAGQRTRFKAFVAIGDYNGHVGLG


Parental protein
VKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKP-HTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKA
VKCSKEVATAIRG.IILAKLSI.PVRRGYWGNKIGKP.HT.P.KVTGRCGSVLV.LIPAPRG.GIVSAPVPKKLLMMAGID.CYTSARGCTATLGNFAKA
Retrocopy
VKCSKEVATAIRGGIILAKLSIIPVRRGYWGNKIGKP\HTAPYKVTGRCGSVLVCLIPAPRGSGIVSAPVPKKLLMMAGIDNCYTSARGCTATLGNFAKA


Parental protein
TFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKNHTRVSVQRTQAPAVATT
TFDAISKTYSYLTPD.WKETVFTKSPYQEFTDHLVKNHTRVSVQRTQAPAVATT
Retrocopy
TFDAISKTYSYLTPDPWKETVFTKSPYQEFTDHLVKNHTRVSVQRTQAPAVATT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide