RetrogeneDB ID:
retro_ecab_1112
Organism:
Horse ( Equus_caballus )
Location:
X:58429251-58429555 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.08 %
Coverage:
68.0 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
UBE2V1
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2 variant 1 [Source:HGNC Symbol;Acc:12494]

Genomic region (view in browser)





>retro_ecab_1112
ACAAGATGGAGAGGGATAATAATTGGGCCTCCAAGAACAATTTATGAAAACTAGATATAC
AACCTTAGAACAGAATGTGGACCTAAATACCCAGAAGCAATCCCCTTGGTAAGATTGGTA
GCAAAAATAATATGAATGTAGTTAATAGTTCTAATGGAGTGGTGAACCCAAGAGTCATAG
TGATGCTAGCAAATAGCAGAATTCATACAACATCAAAGTTGTCTTCCAAGAGCTTCAGTG
CTTAATGATATCCAAAGAAAATATGATACTCCCTCAGCCACCTGAAGAATAATGTTGCAA
CAAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKI-NMNGVNSSNGVVDPRAISVLA-KWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQ
TRW.G.IIGPPRTIYEN.IY.L..ECGPKYPEA.P.VR.V.KI.NMN.VNSSNGVV.PR.I..LA.K.QNSY.IKVV.QEL..LM.SKENM.LPQPPE..
Retrocopy
TRWRGIIIGPPRTIYEN*IYNLRTECGPKYPEAIPLVRLVAKI/NMNVVNSSNGVVNPRVIVMLA/K*QNSYNIKVVFQELQCLMISKENMILPQPPEE*


Parental protein
CYSN
C..N
Retrocopy
CCNN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide