RetrogeneDB ID:
retro_ecab_1113
Organism:
Horse ( Equus_caballus )
Location:
X:58513978-58514755 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.36 %
Coverage:
50.67 %
Frameshifts:
4
Stop codons:
10


Parental gene:
Parental gene symbol:
PPAT
Parental gene aliases:
No gene alias available
Parental gene description:
amidophosphoribosyltransferase [Source:RefSeq peptide;Acc:NP_001098786]

Genomic region (view in browser)





>retro_ecab_1113
TTATGCACTAGTCATCTCATTCCTGTGACTGACGTAAATGGAAAAAGGAAATAAAAATCC
TACAGAAACAGAAGGGTGTGTGGTGATTTCAGAATCTTGTAACTTTTTATCTATTGGTAT
GTATTGCCATGAAGTCTTTCCTAGAGAAATTATGAAAATATCTAGACATTATGTCTAAAC
TTTCAATATTATATTAAGGTCTGAAGGAAATTTGACGTCTCTTTGTATGTTTGAATAGGC
TTATTTTGCAAAACCAGATGGTATATTTGAAGAGCAAATAGTAAGATATCATTGTTGTCA
GCAACTGGCAATTTAAGCACCTGTAAAGAGGAGTTGGTGAGCACATTTCCCAAATTTGCT
GTGCCTGCTGCTCCTGGTTAGTCAGAAAAATGTACATTTCCCTATGTGAAGGTGCTGTAT
AAAAGCTGGTAGTTAGGAATAACTCTCATCCAGCTAATATGAGATTAAGAGAACTTGGTG
TTGAAAAATGAAATTGAAATATTATCAGACAACTTAATAGGTGAAAGAATTGTTCCTATA
GATGATTAACTTGCAAGAGACAATATCATACCGCCCATAACAAAATTTCTCAAAGAATCT
CATGCAAAAGAAATGCAAACTTGAGTAGCTTCATCACCAATATGATTTCCGTGCTTCATG
AGAATAGACATTTCCACAAAAGAGGAGCTTATTGCCAATAAATTTGATCATTTCGCATAA
TATCTGGGAGCAAAGAGCATCACGTATCTGTCACTAGAAGTACTGTTTTCATCTATC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LCIGRLIPISDINDKEK-KS-SETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIIPRSEGNPMAFCIFEYVYFARPDSIFENQMVYTVR
LC...LIP..D.N.K.K.KS..ETEG.VV.SESC.FLSIG..Y..EV.P.EI..ISRH.V.T..II.RSEGN....C.FE..YFA.PD.IFE.Q....VR
Retrocopy
LCTSHLIPVTDVNGKRK*KS\TETEGCVVISESCNFLSIGM-YCHEVFPREIMKISRHYV*TFNIILRSEGNLTSLCMFE*AYFAKPDGIFEEQI---VR


Parental protein
YRCGQQLAIEAPVDA-DLVSTVPESATPAALGYAGKCGLPYVEVLCKNRYVGRTFIQ-PNMRLRQLGVAK-KFGVLSDNFKDKRIVLVDDSIVRGNTISP
Y.C.QQLAI.APV....LVST.P..A.PAA.G...KC..PYV.VL.K....G.T.IQ..NMRLR.LGV.K.....LSDN....RIV..DD...R.N.I.P
Retrocopy
YHCCQQLAI*APVKR/ELVSTFPKFAVPAAPG*SEKCTFPYVKVLYKSW*LGITLIQ/ANMRLRELGVEK\EIEILSDNLIGERIVPIDD*LARDNIIPP


Parental protein
IIKLLKESGAKEVHIRVASPPIRYPCFMGINIPTKEELIANKPEFEHLAEYLGANSVVYLSVEGLVSSV
I.K.LKES.AKE....VAS.PI..PCFM.I.I.TKEELIANK..F.H.A.YLGA.S..YLS.E.L.SS.
Retrocopy
ITKFLKESHAKEMQT*VASSPI*FPCFMRIDISTKEELIANK--FDHFA*YLGAKSITYLSLEVLFSSI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide