RetrogeneDB ID:
retro_ecab_112
Organism:
Horse ( Equus_caballus )
Location:
15:74750987-74751578 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.79 %
Coverage:
98.45 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RHOC
Parental gene aliases:
No gene alias available
Parental gene description:
ras homolog family member C [Source:HGNC Symbol;Acc:669]

Genomic region (view in browser)





>retro_ecab_112
ATGGCGGCCATCCGCAAGAAGCTGGTGGTGGTGGGCGACGGCGCGTGCGGCAAGACGTGC
CTGCTGATCGTGTTCAGTAAGGACGAGTTCCCCGAGGTGTACGTGCCTACCGTCTTTGAG
AACTATGTGGCCGACATCGAGGTGGACGGCAAGCAAGTGGAGCTGGCGCTGTGGGATACG
GCGGGCCAGGAGGACTACGACCGCCTGCGGCCGCTCTCCTACCCGGACACCGACGTGATC
CTCATGTGCTTCTCGGTGGACAGCCCGGATTCGCTGGAGAACATCCCCGAGAAGTGGGTG
CCCGAGGTGAAGCACTTCTGCCCTAACGTGCCCATCATCCTGGTGGCCAACAAGAAAGAC
CTGCGCAGCGACGAGCACGTCCGCACAGAGCTCGCCCGCATGAAGCAGGAACCCGTGCGC
ACAGATGACGGCCGCGCCATGGCCGTGCGCATCCAAGCCTACGACTACCTCGAGTGCTCG
GCTAAGACCAAGGAGGGCGTGCGCGAGGTCTTCGAGACGGCCACGCGCGCCGCGCTGCAG
AAGCGCTACGGCTCCCAGAACGGCTGCATCAACTGCTGCAAGGTGCTATGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 20.91
SRP021940_cerebellum 112.96
SRP021940_embryo 50.53
SRP021940_placental_villous 306.52
SRP021940_synovial_membrane 142.23
SRP021940_testis 16.85

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
MAAIRKKLV.VGDGACGKTCLLIVFSKD.FPEVYVPTVFENY.ADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFS.DSPDSLENIPEKW.
Retrocopy
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWV


Parental protein
PEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
PEVKHFCPNVPIILV.NKKDLR.DEH.R.ELA.MKQEPVR...GR.MA.RI.A..YLECSAKTKEGVREVFE.ATRA.LQ.R......GC
Retrocopy
PEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGS-QNGC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide