RetrogeneDB ID:
retro_ecab_1129
Organism:
Horse ( Equus_caballus )
Location:
X:100478965-100480132 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.15 %
Coverage:
85.43 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
DCAF12
Parental gene aliases:
DCAF12, WDR40A
Parental gene description:
DDB1 and CUL4 associated factor 12 [Source:HGNC Symbol;Acc:19911]

Genomic region (view in browser)





>retro_ecab_1129
CTGCGCGGCTACGCGGTGCAGAAGCTGCCCGAGCTGCTGCGGGAGCGCGAGCTGGCCCTG
GGCACCCTCAACAAGGTGTTCGCGTCGCAGTGGCTGAACGCCAGGCAGGTGGTGTGCGGC
ACCAAGTGCAACACGCTCTTCGTGGTGGACGTGCAGTCGGGCCAGATCACGCGCATCCCC
CTCATGCGGGACCGGGAACCCGGGCCGGCTCGGGCCCAGCCGAGCTGCGGCATCCACGCC
ATCGAGTTGAATCCCTCCAAGACGCTTCTGGCCACGGGGGGCGAGAACCCCAACAGTCTG
GCTGTCTACCAGCTGCCCACCCTGGACCCCGTGTGCCTGGGCGACCGCCTCGGCCACAGG
GACTGGATCTTCGCCATCGCCTGGATAAGCGACACCGTGGTCGTGAGCGGTTCCCGCGAT
GGCACCGTGGCTCTGTGGCGGATGGACCCCGACATATTCAATGGCAGCATCGCCTGGCAC
AATGACGCGGGGCTCCCCGTGTACGCCCACATCCGTCCAAGGGACTTGGAGACCATCCCC
AGGGCCAACACCAACCCCAGTAACCGCAAGGTACGGGCCCTGGCTTTTAATCGCAAGAAC
CAGGAGCTGGGAGCGGTGTCCCTGGACGGCTACTTCCACCTGTGGAAAGCCCGGAGCACC
CTGTCCAGGCTGCTGTCCATCAGGCTGCCCTACTGCCGAGAGAACGTGTGCCTAACCTAC
TGCGACGAGTTGTCCCTGTACGCGGTGGGCTCCCAATCCCACGTCTCCTTCCTGGATCTG
CGCCATGGTCACCAAAACATCCGGCCCCTGTGCTCTCGAGAGGGCGGCACGGGCGTGCGC
TCGCTGAGCTTCTACCAGCACATCGTCACCGTGGGCACGGGCCACGGCTCCCTGCTCTTC
TATGACGTCAGAGCCCAGAAGTTCCTGGAGGAGAAGGCCTTGGCCAGCCCGGACTCCTCT
CCCGGGCCCGCAGCGAGGAAGCTCAAGCTCACCTGTGGCAGAGGCTGGCTCAACCACGAT
GACCTGTGGGTGAACTACTTTGGCGGCGTAGGCGAGTTCCCCAACGCGCTCTACACCCAC
TGCTACAACTGGCCTGAGATGAAGCTCTTCGTGGCTGGGGGCCCTCTCCCTTCAGGCCTC
CATGGGAACTACGCAGGCCTCTGGAGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.35
SRP021940_embryo 0.36
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 1.54

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LHGYAAQQLPGLLKEREFHLGTLNKVFASQWLNHRQVVCGTKCNTLFVVDVQTSQITKIPILKDREPGCV-TQQGCGIHAIELNPSRTLLATGGDNPNSL
L.GYA.Q.LP.LL.ERE..LGTLNKVFASQWLN.RQVVCGTKCNTLFVVDVQ..QIT.IP...DREPG....Q..CGIHAIELNPS.TLLATGG.NPNSL
Retrocopy
LRGYAVQKLPELLRERELALGTLNKVFASQWLNARQVVCGTKCNTLFVVDVQSGQITRIPLMRDREPGPARAQPSCGIHAIELNPSKTLLATGGENPNSL


Parental protein
AIYRLPTLDPVCVGDD-GHKDWIFSIAWISDSMAVSGSRDGSMGLWEVTDDVLTKSDARHNVSRVPVYTHITHKALKDIPKEDTNPDNCKVRALAFNNKN
A.Y.LPTLDPVC.GD..GH.DWIF.IAWISD...VSGSRDG...LW....D....S.A.HN....PVY.HI....L..IP...TNP.N.KVRALAFN.KN
Retrocopy
AVYQLPTLDPVCLGDRLGHRDWIFAIAWISDTVVVSGSRDGTVALWRMDPDIFNGSIAWHNDAGLPVYAHIRPRDLETIPRANTNPSNRKVRALAFNRKN


Parental protein
KELGAVSLDGYFHLWKAENTLSKLLSTKLPYCRENVCLAYGSEWSVYAVGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYEHIITVGTGQGSLLF
.ELGAVSLDGYFHLWKA..TLS.LLS..LPYCRENVCL.Y..E.S.YAVGSQ.HVSFLD.R....N....CSRE.G.G.RS.SFY.HI.TVGTG.GSLLF
Retrocopy
QELGAVSLDGYFHLWKARSTLSRLLSIRLPYCRENVCLTYCDELSLYAVGSQSHVSFLDLRHGHQNIRPLCSREGGTGVRSLSFYQHIVTVGTGHGSLLF


Parental protein
YDIRAQRFLEERLAACYGSKPKLAGENLKLTTGKGWLNHDETWRNYFSDIDFFPNAVYTHCYDSSGTKLFVAGGPLPSGLHGNYAGLWS
YD.RAQ.FLEE...A...S.P..A...LKLT.G.GWLNHD..W.NYF.....FPNA.YTHCY.....KLFVAGGPLPSGLHGNYAGLWS
Retrocopy
YDVRAQKFLEEKALASPDSSPGPAARKLKLTCGRGWLNHDDLWVNYFGGVGEFPNALYTHCYNWPEMKLFVAGGPLPSGLHGNYAGLWS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide