RetrogeneDB ID:
retro_ecab_115
Organism:
Horse ( Equus_caballus )
Location:
28:37312907-37313255 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.86 %
Coverage:
94.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL35
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L35 [Source:HGNC Symbol;Acc:10344]

Genomic region (view in browser)





>retro_ecab_115
ATGGCCAAGACTAAGCCTCGAGGCCTTCACAGCAAGAAGGAAGAGCTGCTGAAACAGCTG
GATGAACTGAAGGTGGAGCTGTCCCAGCTGCATGTCACCAAAGTGACTGGTGGTGTGGTA
TCCAAGCTGTCCAAGAGTAGAGATGCTCGCAAATCCATCACCCGTGTTCTCACTGTCATT
AAACAGATGCAGAAAGAGAACCTCAGGAAATTCTACAAGGGCAAGAGGTGCAAGCCCCTG
GATCTGCGGCCCAAGAACACACGTGCCACATGCCGCTGGCTCAATAAGTACAAAGAGAAC
CTGAAGACCAAGACGCAGCAGCTGAAGGAGCAGCTGTACCCACTGTAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.05
SRP021940_embryo 0.02
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEE
MAK.K.R.L..KK.EELLKQLD.LKVELSQL.V.KVTGG..SKLSK.R..RKSI.RVLTVI.Q.QKENLRKFYKGK..KPLDLRPK.TRA..R.LNK..E
Retrocopy
MAKTKPRGLHSKK-EELLKQLDELKVELSQLHVTKVTGGVVSKLSKSRDARKSITRVLTVIKQMQKENLRKFYKGKRCKPLDLRPKNTRATCRWLNKYKE


Parental protein
NLKTKKQQRKERLYPL
NLKTK.QQ.KE.LYPL
Retrocopy
NLKTKTQQLKEQLYPL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide