RetrogeneDB ID:
retro_ecab_116
Organism:
Horse ( Equus_caballus )
Location:
30:18649246-18649711 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.89 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
UBE2L3
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2L 3 [Source:HGNC Symbol;Acc:12488]

Genomic region (view in browser)





>retro_ecab_116
ATGGCGGCCAGCAGGAGGCTGATGAAGGAGCTTGAAGAAATCCGCAAATGTGGAATGAAA
AACTTCCGTAACATCCAGATTGATGAAGCTAATTTATTGACTTGGCAAGGGCTTATTGTT
CCTGACAACCCTCCATATGACAATGGGACCTTCAGAATCGAAATCAACTTTCCGGCAGAG
TACCCATTCAAACCACCGAAGATCACATTTAAAACAAAGATCTATCACCCGAACATTGAT
GAAAAGGGGCAGGTCTGTCTGCCGGTAATTAGTGCTGAAAACTGGAAGCCAGCAACCAAA
ACCGACCAAGTAATCCGGTCCCTCATAGCACTGGTGAACGACCCCCAGCCTGAGCACCCG
CTTCGGGCTGACCTAGCTGAAGAATACTCTAAGGACCGTAAAAATTTCTGTAAGAACGCT
GAAGAGTTTACAAAGAAATATGGGGAAAAGCGACCTGTGGACTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.46
SRP021940_cerebellum 1.89
SRP021940_embryo 2.59
SRP021940_placental_villous 1.74
SRP021940_synovial_membrane 1.38
SRP021940_testis 5.34

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSL
.ELEEIRKCGMKNFRNIQ.DEANLLTWQGLIVPDNPPYD.G.FRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVI.SL
Retrocopy
KELEEIRKCGMKNFRNIQIDEANLLTWQGLIVPDNPPYDNGTFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIRSL


Parental protein
IALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
IALVNDPQPEHPLRADLAEEYSKDRK.FCKNAEEFTKKYGEKRPVD
Retrocopy
IALVNDPQPEHPLRADLAEEYSKDRKNFCKNAEEFTKKYGEKRPVD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide