RetrogeneDB ID:
retro_ecab_118
Organism:
Horse ( Equus_caballus )
Location:
1:17358654-17359014 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.9 %
Coverage:
53.78 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
SNRPB2
Parental gene aliases:
No gene alias available
Parental gene description:
small nuclear ribonucleoprotein polypeptide B [Source:HGNC Symbol;Acc:11155]

Genomic region (view in browser)





>retro_ecab_118
CAAAGAAAGGAAAAAAGCCAATCTGTGGAATAGACTGCAACAACCACAAACAAAACAGCT
GGTCAGGAAATACCAAATCAGCAAACACCCAGAGACATTCAACCCCAAACCCTCAGGTCC
CCCATTACCCTCTCAACTATGTTGTATTCCTTAATAACTTACCGAAAGAGATGAATGAGA
TGATGTTATCCATGTGATGTAGTCAGTTCCTGGTTTCAAGGAAGTACATTCGGTACCTGG
GAGAGACAACGTTGCTGTTGTTGAATTCGAAAATGACACGCAGGCTGGAGGTGCCAGGGT
ACTTTACGAGGATTTTGGGTCACGCTGCCCCATACCATGAAGATCGCCTAGGTCAAGAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.5
SRP021940_embryo 0.14
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.31
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KEKKKAKTVEQTATTANKKPGQGTPN-SVNTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQF-PGFKEVRLVPGRHDIAFVEFENDGQAGA
..K.K...VE.TATT.NK..GQ..PN.S.NTQ..STPNPQVP.YP.NY..FLNNLP.E.NEMMLSM...QF.PGFKEV..VPGR...A.VEFEND.QAG.
Retrocopy
QRKEKSQSVE*TATTTNKTAGQEIPN/SANTQRHSTPNPQVPHYPLNYVVFLNNLPKEMNEMMLSM*CSQF/PGFKEVHSVPGRDNVAVVEFENDTQAGG


Parental protein
AR-DALQGFKITPSHAMKITYAKK
AR...L.GF..T..H.MKI...KK
Retrocopy
AR/GTLRGFWVTLPHTMKIA*VKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide