RetrogeneDB ID:
retro_ecab_12
Organism:
Horse ( Equus_caballus )
Location:
15:9144569-9144932 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.21 %
Coverage:
87.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CYB5A
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome b5 [Source:RefSeq peptide;Acc:NP_001153204]

Genomic region (view in browser)





>retro_ecab_12
CTGGAAGAGAACAGGAAGCACAACCACAGCGAGAGCACCTGGCTGATCCTGCACCACAAG
GTGTATGATTCGACCACATTTTTGGAGGAGCATCCTGGTGGGCAAGCAGTCTTACGGGAA
CAAGCTGGTGGTGATGCTACTGAAAACTTTGAGGATGTCAGGCACTCTGCAGATGCTAGA
GAATTGTCCAAAGCATGTGTCATTGGGGAGCTTCATCCAGATGACAGATCAAAGATAACC
AAGGCTTCGGAAACTGTTATTACTACTATTGATTCTAATTCCAGCTGGTGGACCAATTGG
GCGATCCCAGCCATCTCAGCACAGGTCGTGGCCCTGATGTATCGCCTCTACATGGTACTT
TCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LEEIKKHNHSKSTWLILHHKVYDLTKFLDEHPGGEEVLREQAGGDATENFEDIGHSTDARELSKTFIIGELHPVSTFLGAFTYETLITTVDSNSSWWTNW
LEE..KHNHS.STWLILHHKVYD.T.FL.EHPGG..VLREQAGGDATENFED..HS.DARELSK...IGELHP..........ET.ITT.DSNSSWWTNW
Retrocopy
LEENRKHNHSESTWLILHHKVYDSTTFLEEHPGGQAVLREQAGGDATENFEDVRHSADARELSKACVIGELHPDDRSKITKASETVITTIDSNSSWWTNW


Parental protein
VIPAISAVVVALMYRIY
.IPAISA.VVALMYR.Y
Retrocopy
AIPAISAQVVALMYRLY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide