RetrogeneDB ID:
retro_ecab_120
Organism:
Horse ( Equus_caballus )
Location:
1:34200314-34201173 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.08 %
Coverage:
78.85 %
Frameshifts:
7
Stop codons:
2


Parental gene:
Parental gene symbol:
SMARCB1
Parental gene aliases:
No gene alias available
Parental gene description:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:11103]

Genomic region (view in browser)





>retro_ecab_120
GAAGCCTCTGAGGTGGAAGAGATAGTAGACAGCAAGGATGAGAAATACAAGGTATGTGTC
CATCAGCATGGAGCCCCCAAACTACTTCAGGGAACAGAAAACCAAGAGGCACAGCCAGTG
GGTGCCCATCTTGCCCAACATTTCTCACCATCTGGATACTGTGCCATGCTCTACTACCAT
TAACAGCAGCCTCACAGGCTGGGACAAGAAGAGAACGTTCCCTCTCTGCTTTGATGATCA
CGACCCACCTGTGATCCATGACAACATGACCCAGCCTGTGGTGTTAGTCCCCATCTCACT
GGAAATGGAGACCAAGGGGCAGAAGGTGCCAGACCCTTTACCTGAAACAAGAATGAGAAG
CCAATGACCCCTGAGACATCTTCGGAAATCTTCTGTGACCACCTAGATTTGAACTTGCAG
ACATTGTTTCAGCTATCACCTCTGCCATCACACAGAAGATCAAGTCCTACCCACCCACAG
AATCCTGGAGGACCAGTTGGAGCAGTGCGTCATCATTAAGCTGAACAACCCTTTGGGAAA
TGTTGCCGTAGTGGATCAGTAGAGTGGGACATGTCAGAGAAGGAGAACTCCCTAGAGAAC
CTTGCCCTGAAGCTGTCTTCAGAGCTGGGGCTGGGCATGGAGGAGGTTGTCACCACCGCT
GCATACAACATTCAGGGACAGTCTAGCTGGCATAGGAAGACCTACACCTTCAGGGAGAAT
GCCCTGCCTATGGTGAAGATTGCCATCGGAACACAGGCGGTGCTAATTAGTGGTGCCCAC
TACTGGAGACATTGATGATGCCAAGATGAAAAATAAGATCTGTGACCAGGACAAGAACAC
GAGGCATTTGAGATATCTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KASEVEEILDGNDEKYKA-VSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIR
.ASEVEEI.D..DEKYK..VSIS.EPP.Y.REQK.KR.SQWVP.LPN.SHHLD.VPCSTTIN....G.DKKRTFPLCFDDHDP.VIH.N..QP.VLVPI.
Retrocopy
EASEVEEIVDSKDEKYKV\VSISMEPPNYFREQKTKRHSQWVPILPNISHHLDTVPCSTTINSSLTGWDKKRTFPLCFDDHDPPVIHDNMTQPVVLVPIS


Parental protein
LDMEIDGQKLRD-AFTWNMNEKLMTPEMFSEILCDDLDLNPLT-FVPAIASAIRQQIESY-HLDAVSRDKGQKRVCWPLNIHVGNISLVDQ-FEWDMSEK
L.ME..GQK..D..FT.N.NEK.MTPE..SEI.CD.LDLN..T..V.AI.SAI.Q.I.SY........D.....V...LN...GN...VDQ..EWDMSEK
Retrocopy
LEMETKGQKVPD/PFT*NKNEKPMTPETSSEIFCDHLDLNLQT/IVSAITSAITQKIKSY/PTHRILEDQLEQCVIIKLNNPLGNVAVVDQ/VEWDMSEK


Parental protein
ENSPEKFALKLCSELGLG-GEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAI-RNTGDADQWCPLLETL-TDAEMEKKIRDQDRNTRRMRRL
ENS.E..ALKL.SELGLG..E.VTT.AY.I.GQ.SWH.KTY.F.EN.LP.V.IAI.RNTG.A..WCPLLETL..DA.M..KI.DQD.NTR..R.L
Retrocopy
ENSLENLALKLSSELGLGMEEVVTTAAYNIQGQSSWHRKTYTFRENALPMVKIAI/RNTGGAN*WCPLLETL/DDAKMKNKICDQDKNTRHLRYL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide