RetrogeneDB ID:
retro_ecab_121
Organism:
Horse ( Equus_caballus )
Location:
1:34505219-34505797 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.39 %
Coverage:
53.02 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
SMARCB1
Parental gene aliases:
No gene alias available
Parental gene description:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:11103]

Genomic region (view in browser)





>retro_ecab_121
AAGAAAACAGTTGTATCCTCACATGGTCATGGATACATGATCCTGGCCACTAGTGTGACT
CAGTTAAAAGCCTCAGTGGTGGAAGAGATTCTGGAGGACAATGATGAGAAACACAAGGCA
TGTGTCCATCAGCATAGGGTTCCCCATCCATTTCAGGGAATGAGAAATCAAGAGGAATAG
CCAGTGGGTGCCCACCCTGCTCAGCAGCTCTCACCATCTGCACACCGTGCCATGCTCCAC
AGCCATTAATAGGAACCTCATGGGCTAAGATAAGAAAGGAAGCTTCCCTCTCTGCTTTGA
TGATCATGACCCACCTGTGATCCATGAGAACACATCCCAGTCTAAAGTTTTGGTTCCCAT
CCGGCTGGACACGGAGATAGATGGGTAGAAGTGGAGGATGCCTTTACATGAAACATGAAT
AAGAAGCTGATGACCTCTGAGATGTTTTCAGAAATCCTCTGTGACCACTTGGATTTGAAC
CCACTCATATTCATTCCTGCTTTCACCTCCATCATCAGACAGCAGATGGAGTCCTACCCA
CTGACAGCATCTTGGAGGACCAGTCCGACCAACGTGTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKA-VSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCF
KKT......HGY..LATSVT.LKAS.VEEIL..NDEK.KA.VSIS...P...RE...KRNSQWVPTL..SSHHL..VPCST.INRN.MG.DKK..FPLCF
Retrocopy
KKTVVSSHGHGYMILATSVTQLKASVVEEILEDNDEKHKA\VSISIGFPIHFRE*EIKRNSQWVPTLLSSSHHLHTVPCSTAINRNLMG*DKKGSFPLCF


Parental protein
DDHDPAVIHENASQPEVLVPIRLDMEIDGQKLR-DAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYHL-DAVSRDKGQKRV
DDHDP.VIHEN.SQ..VLVPIRLD.EIDG.K.R.DAFT.NMN.KLMT.EMFSEILCD.LDLNPL.F.PA..S.IRQQ.ESY.L.D....D....RV
Retrocopy
DDHDPPVIHENTSQSKVLVPIRLDTEIDG*KWR/DAFT*NMNKKLMTSEMFSEILCDHLDLNPLIFIPAFTSIIRQQMESYPL/DSILEDQSDQRV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide