RetrogeneDB ID:
retro_ecab_124
Organism:
Horse ( Equus_caballus )
Location:
1:42515879-42516705 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.86 %
Coverage:
94.3 %
Frameshifts:
1
Stop codons:
5


Parental gene:
Parental gene symbol:
GPS2
Parental gene aliases:
No gene alias available
Parental gene description:
G protein pathway suppressor 2 [Source:HGNC Symbol;Acc:4550]

Genomic region (view in browser)





>retro_ecab_124
ATGCCTTTGCTCCTGGAGTGGCCCATGCTTTCCAGTACAACAGCCAGGGTACTGTGCCAG
CACATCATGATGGAGTGGGAGTTGCATGCAGCAACAGGAAGAAGAGCTGGACAAGGTGAT
GAAGGAAGAGCAGGAGACAAGGATGAAAAAGGACATGGAAGAGAGAATGTCACCAGAGGA
GATCAAGGAACAGATCCTGAAGGTGCAGGAGAAGCTTTTGGCCCTACAGGAAGAGAAGAA
TCTGCTTTTTCTGTAGCTCAAGAAAGTTTCACATGAGGAAGGGAAATGGAGGCGAAAGGA
GCAGAGTGAGCTAACTACTCTGGCATCTGATGCCTGCCCTTGGTGCCTCACTGTTCACAC
AGGAACTCGCCTCCTCAGCACACATAGCAGCCCTGGAGGACACAGTCCCCCAGGCATCCT
CATGGCGACTGACAGAACCTAGCAGATGTTCGGACAGCAAGTGATTACAACCTGGCACTA
CAAGGGCGCAGCAGTTGCCTTTGCAGGGAGCCCAGAGCATGGGCGATTCCCAGAAAGCCC
AGGTGGCACCTATGGGACTGCTTAGCCCCCAACTCTCTATAGGCCCAGCCAGCCAGCCTA
TGGTCCCATGCAGCAGCTCAGAGCACCTTCAGCATTTCCTGCAGTGTGATTCCTGTTTCA
GCCGCAGCCTTAGGCAGTGCACAATGACTTTCAGGCCAGCCAGACAGGGTTTCTCCAGCC
TGGTGGTGTCCTGTCCTTACAAAAGCAGATGGAACACACCAAACAGCAGACCAGCTTCTC
TGACTCATCCTCCCCGTGCCCCATTCACCCCCAAGCTCTGCATCCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.19
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPALLERPKLSNAMARALHRHIMMERERK-RQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLQEKLLALQEEKHQLFLQLKKVLHEEEK
MP.LLE.P.LS...AR.L..HIMME.E....Q.EEE.DK.....MKEEQE.R.KK.MEERMS.EE.KEQILK.QEKLLALQEEK..LFL.LKKV.HEE.K
Retrocopy
MPLLLEWPMLSSTTARVLCQHIMMEWELH\QQQEEELDKV----MKEEQETRMKKDMEERMSPEEIKEQILKVQEKLLALQEEKNLLFL*LKKVSHEEGK


Parental protein
RRRKEQSDLTTLTSAAYQQGLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGP
.RRKEQS.LTTL.S.A....LTVHTGT.LLS...SPGGH..PG.LMA.DR..QMFG.QV.TT.HY.G.A.AFAG.PEHG.F..SPGG.YGTA.PP..Y.P
Retrocopy
WRRKEQSELTTLASDACPWCLTVHTGTRLLSTHSSPGGHSPPGILMATDRT*QMFGQQVITTWHYKGAAVAFAGSPEHGRFPESPGGTYGTA*PPTLYRP


Parental protein
TQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHSHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHP
.QPAY.P.QQLRAPSAFPAV..L...QPQP.AVH..FQ..QTGFLQPGG.LSLQKQMEH..QQT.FSDSSS..P.HPQALHP
Retrocopy
SQPAYGPMQQLRAPSAFPAV*FLF--QPQP*AVHNDFQASQTGFLQPGGVLSLQKQMEHTKQQTSFSDSSSPCPIHPQALHP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide