RetrogeneDB ID:
retro_ecab_128
Organism:
Horse ( Equus_caballus )
Location:
1:57249023-57249836 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.85 %
Coverage:
62.16 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
CYP2R1
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome P450, family 2, subfamily R, polypeptide 1 [Source:HGNC Symbol;Acc:20580]

Genomic region (view in browser)





>retro_ecab_128
TCAGCCTTTCCATGGATTGGCATCTTACCTTTTGGAAAACATCAACAGCTGCTTAGAAAT
GCAGCTGTGGCCTACGATTTTTCTCCCCAGGCTTATTGAAAAAGTTCCTGGTGACAAAAA
GCCTCAGTTGCCTCAGCATTTTGTTGGTGCTTATTTAGATGAGATGGATCAAGGTAAAAA
TGACCCATCGTCTGCTTTCTCCAAAGAAAAGCTAATTTTCTCTGTGGATGAACTCATCAT
TGCTGGAACCAAAACTATAACCAATGTGCTATGGTGGGCAGTTCTTTTCATGGCCCTTTA
TCCTAACATTCAAGGACGGGTTCAGAAGGAGCTTGATTTAATTATGGGACCCAGTGGGAA
GCCATCTTGGGATGACACATGCAAAATGCCTTATACTGAGGCAGTTTTGTGTGAAGTTTT
AAGATTCTGTAATATAGCGCCATTAGCGATTTTCCATGGAGCCTCTGTAGATGTAGTTGT
ATGTGGTGATTCCATTCCTAAAGGCAAAGCAGTTATTACAAATCTTTATTCTGTACACTT
CAATGAAGAGTACTGGAGAGACCCAGAAGTATTCTATCCTGAGCAATTTCTGGACAGCAG
TGGACTTTTTGCCGAGAAGGAAGCTTTGCTTCCTTTTTGCTTAGGAAGAAGAGATGGTCC
TGGAGAACAGCTGGCTCAGTGGAAATGTTCCTGTTTTTTACAGCATTGCTTCAGCTGTTT
CACTTGCATTCTCCAGATGAACTGGTTCCAAATCTGAAGCCCAGGTTAGGCATGACATGC
CAACCGCAGCCTTACCTCATCTGTGCAGAAAGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.14
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NAFPWIGILPFGKLQQLFRNADVVYEF-LSRLIEKVSVNRKPQLPQHFVDAYLDEMDQGQNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMAL
.AFPWIGILPFGK.QQL.RNA.V.Y.F.L.RLIEKV....KPQLPQHFV.AYLDEMDQG.NDPSS.FSKE.LIFSV.ELIIAGT.T.TNVL.WA.LFMAL
Retrocopy
SAFPWIGILPFGKHQQLLRNAAVAYDF\LPRLIEKVPGDKKPQLPQHFVGAYLDEMDQGKNDPSSAFSKEKLIFSVDELIIAGTKTITNVLWWAVLFMAL


Parental protein
YPNIQGQVQKEIDLIMGPSGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDTVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEIFYPERFLDS
YPNIQG.VQKE.DLIMGPSGKPSWDD.CKMPYTEAVL.EVLRFCNI.PL.IFH..S.D.VV.G.SIPKG..VITNLYSVHF.E.YWRDPE.FYPE.FLDS
Retrocopy
YPNIQGRVQKELDLIMGPSGKPSWDDTCKMPYTEAVLCEVLRFCNIAPLAIFHGASVDVVVCGDSIPKGKAVITNLYSVHFNEEYWRDPEVFYPEQFLDS


Parental protein
SGYFAKKEAFIPFSLGRRHCLGEQLAR-MEMFLFFTALLQRFHLHFPHELVPNLKPRLGMTLQPQAYLICAER
SG.FA.KEA..PF.LGRR...GEQLA...EMFLFFTALLQ.FHLH.P.ELVPNLKPRLGMT.QPQ.YLICAER
Retrocopy
SGLFAEKEALLPFCLGRRDGPGEQLAQ/VEMFLFFTALLQLFHLHSPDELVPNLKPRLGMTCQPQPYLICAER


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide