RetrogeneDB ID:
retro_ecab_138
Organism:
Horse ( Equus_caballus )
Location:
1:98867223-98867583 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.6 %
Coverage:
98.39 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
LAMTOR3
Parental gene aliases:
No gene alias available
Parental gene description:
late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606]

Genomic region (view in browser)





>retro_ecab_138
AAGGACCTAACGTGATTCCTGTGTCAAAAACAACTGCGTGTGGAAGGGTTCCAGGCTACT
GCTGTGTCAGATGGGGACGGAGTGGGGTTATCACCGTGGCCAATGCAAGCGCTCCAGATC
ACGCTTTGAGACCCAGTTTCTTACCTGCTTTTGTCCTCGCAACAGACCAGGTAGTAAGCT
TGGACTTTCAAAAAACAGAAGTATTATCTGTTCCTTTAACACCTAGCAGGTGGTTCCATT
TAAACATTTGCCCTTGGTGAGCAGTTTCACGGCCAGCAGCAAAGCCAATGCAGCACTGTC
AGCCGAGAAAAGGAACGTGCTCCACTATTTGAAGACTTGAGACAAGCCGTGGAAGTTTCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QDLKRFLYKKLPSVEGLHAIVVSDRDGVP-VIKVANDNAPEHALRPGFLSTFALATDQ-GSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNANT
.DL..FL..K...VEG..A..VSD.DGV..VI.VAN..AP.HALRP.FL..F.LATDQ.GSKLGLSKN.SIIC..NT.QVV.F..LPL.VS....S....
Retrocopy
KDLT*FLCQKQLRVEGFQATAVSDGDGVG/VITVANASAPDHALRPSFLPAFVLATDQ/GSKLGLSKNRSIICSFNT*QVVPFKHLPL-VSSFTASSKAN


Parental protein
GLI-VSLEKELAPLFEELRQVVEVS
....VS.EKE.APLFE.LRQ.VEVS
Retrocopy
AAL/VSREKERAPLFEDLRQAVEVS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide