RetrogeneDB ID:
retro_ecab_14
Organism:
Horse ( Equus_caballus )
Location:
11:44606967-44607216 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.42 %
Coverage:
95.4 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
DBI
Parental gene aliases:
No gene alias available
Parental gene description:
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690]

Genomic region (view in browser)





>retro_ecab_14
ATGTGCCAGGTGGAGTTTGAGCTGGCCTGTGCTGCTATCAAGCAGTTAAAGGGACCTGTG
AGCGATCAGGAGAAACTGTTGGTGTACAGCTTCTACAAACAGGCTACCCAGGGCGACTGC
AACATCCCGGCCCCACCCGCCACAGACGTGAAAGCCAAGGCCAAGTGGGACGCGTGGAAC
GACAAGAAAGGGATATCCAAGATGGACGCCATGAGGATCTATGTTGCCAAAGTGGAAGAA
CTGAAGAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.05
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.03
SRP021940_testis 108.05

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSQAEFDRAAEEVKNLKTKPADDEMLFIYSHYKQATVGDVNTERPGMLDLKGKAKWDAWNALKGTSKEDAMKAYINKVEDLKK
M.Q.EF..A....K.LK....D.E.L..YS.YKQAT.GD.N...P...D.K.KAKWDAWN..KG.SK.DAM..Y..KVE.LKK
Retrocopy
MCQVEFELACAAIKQLKGPVSDQEKLLVYSFYKQATQGDCNIPAPPATDVKAKAKWDAWNDKKGISKMDAMRIYVAKVEELKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide