RetrogeneDB ID:
retro_ecab_140
Organism:
Horse ( Equus_caballus )
Location:
1:117880136-117881438 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.81 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
NADK
Parental gene aliases:
No gene alias available
Parental gene description:
NAD kinase [Source:HGNC Symbol;Acc:29831]

Genomic region (view in browser)





>retro_ecab_140
ATGGAAGTGGAACAAGAGAAAGTCAACATGAGTAAGGAGCTGAGTGCAGATGCGGCCTCG
TACCGCTGCTCCGCGTGTCATGGGGACGAGGACTGGGGGCTCAGCCACCCCCATGCGGGG
GCGGGCCAAGTCCCGCAGCTTGTCTGCCGCGCTGGCCCTGGCAAGCACCAAGGAGTTCAG
GAGGACCCGCTCCCTGCACAGGCCGTGCCCAGTGACCACTTTTGGACCAAAGGCCTGCGT
GCTGCAGAACCCCCAGACCATCATGCACATCCAGGACCCTGCTAGCCAGTGGTTGACGTG
GAACAAGTCCCCAAAGAGTGTTCTCGTCATCAAGAAGATCCGTGACGCCAGCCTGCCCCA
GCCCTTCAAGGAGCTCTGCATGTACCTGATGGAGGAGAACAACATGATTGTGTATGTGGA
GAAGAAAGTTCTAGAAGACCCTGCCATAGTGAGTGACGACAGCTTTGGGCCAGTGAAGAG
GAAGTTCTGCACCTTCAGAGAAGATTATGACGACATCTCCAATCAGATCGACCTCATCAT
CTGCCTGGGTGGGGACGGGACCCTGCTCTACGCCTCCTCCCTCTTCTCGGGCAGCGTGCC
TCGGGTCATGGCTTTTCACCTGGCCTCCCTGGGCTTCCTGACCCCCTTCAACTTTGAGAA
CTTTCAGTCCCAAGATACTCAGGTGATACAGGGGAATGCAGCTGTTGTTCTTCGGAGCCG
GCTGAAGGTCAGGGTCGTGAAGGAGCTTAGAGGGAAGATGGCCATCCCCAACGGGATCAG
CGAGAACGGGGTGCTGGCTGCAGACCTGGACACAGAGGTCGGGAAGCAGGTCATGCAGTA
CCAGGTCTTGAATGAGGTGTTGATCGACTGAGGTCCGTCCTCGTACCTGTCCAACGTGGA
CGTCTACCTGGACGGGCACCTCATCACCACGGTGCAGGGCGACGGGGTGATTGTGTCCAC
CCCGACGGGCAGCACAGCGTATGCGGCGACAGCGGGGCCTCCATGATCCACCCCAACGTG
CCAGCCATCATGATCACACCTATCTGCCCCCACTCACTGTCATTCCGGCCCATCGTGGTC
CCTGCGGGGGTCGAGCTGAAGATCATGCTATCACCGGAAGCTAGAAACACCGCCTGGGTG
TCCTTTGATGGACGAAAGAGACAGGAGATCCGCCGCGGAGACAGCATCAGCATTGCTACC
TCTTGCTACCCCGTGCCCTCCATCAGCGTCCGAGACCCCATGAGCAACTGGTTTGAGAGC
TTGGCTCAGTGTCTGCACTGGAACGTGCGGAAGAAGCAGGCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.46
SRP021940_cerebellum 0.15
SRP021940_embryo 1.46
SRP021940_placental_villous 1.25
SRP021940_synovial_membrane 1.69
SRP021940_testis 3.2

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEVEQEKVNMSKELSADAASYRCSACHGDEDWGLSHP-MRGRAKSRSLSAAPAPASTKEFRRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLT
MEVEQEKVNMSKELSADAASYRCSACHGDEDWGLSHP.MRGRAKSRSLSAA.A.ASTKEFRRTRSLH.PCPVTTFGPKACVLQNPQTIMHIQDPASQ.LT
Retrocopy
MEVEQEKVNMSKELSADAASYRCSACHGDEDWGLSHP\MRGRAKSRSLSAALALASTKEFRRTRSLHRPCPVTTFGPKACVLQNPQTIMHIQDPASQWLT


Parental protein
WNKSPKSVLVIKKIRDASLLQPFKELCMYLMEENNMIVYVEKKVLEDPAIVSDDSFGPVKRKFCTFRE-YDDISNQIDLIICLGGDGTLLYASSLFQGSV
WNKSPKSVLVIKKIRDASL.QPFKELCMYLMEENNMIVYVEKKVLEDPAIVSDDSFGPVKRKFCTFRE.YDDISNQIDLIICLGGDGTLLYASSLF.GSV
Retrocopy
WNKSPKSVLVIKKIRDASLPQPFKELCMYLMEENNMIVYVEKKVLEDPAIVSDDSFGPVKRKFCTFREDYDDISNQIDLIICLGGDGTLLYASSLFSGSV


Parental protein
PPVMAFHLGSLGFLTPFNFENFQSQVTQVIQGNAAVVLRSRLKVRVVKELRGKMAIPNGISENGVLATDLDTEVGKQVMQYQVLNEVVIDRGPSSYLSNV
P.VMAFHL.SLGFLTPFNFENFQSQ.TQVIQGNAAVVLRSRLKVRVVKELRGKMAIPNGISENGVLA.DLDTEVGKQVMQYQVLNEV.ID.GPSSYLSNV
Retrocopy
PRVMAFHLASLGFLTPFNFENFQSQDTQVIQGNAAVVLRSRLKVRVVKELRGKMAIPNGISENGVLAADLDTEVGKQVMQYQVLNEVLID*GPSSYLSNV


Parental protein
DVYLDGHLITTVQGDGVIVSTPTGSTAYAAAA-GASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISI
DVYLDGHLITTVQGDGVIVSTPTGSTAYAA.A.GASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIR.GDSISI
Retrocopy
DVYLDGHLITTVQGDGVIVSTPTGSTAYAATA/GASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRRGDSISI


Parental protein
TTSCYPLPSICVRDPVSDW-RAWLQCLHWNVRKKQA
.TSCYP.PSI.VRDP.S.W.....QCLHWNVRKKQA
Retrocopy
ATSCYPVPSISVRDPMSNWFESLAQCLHWNVRKKQA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide