RetrogeneDB ID:
retro_ecab_141
Organism:
Horse ( Equus_caballus )
Location:
1:120956445-120957041 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.95 %
Coverage:
72.76 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
NDUFAF6
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 [Source:HGNC Symbol;Acc:28625]

Genomic region (view in browser)





>retro_ecab_141
TGGAAAGCTGCTGTCAAGAAACATAATTTGACTAAAAGATGGCTTATGAGAGTCATTGAT
GAAGGAGAAAAAAATTGGATGACAAAGCATATTGCAATATCCAGGAACTGGAAAATTATG
CTGAAAACACACAGAACTCTCTTCTTTATTTGACACCAGAAATATTGGGTATAATGACCT
TCATGAAGATCATGTCACAAGCCACACTGGAAAAGCACAAGGTATTGTCACATGCTTGAG
AGCAACGTCCTATAGTGGTAGCAGAAGAAGGGTGTGCCCTCCCTTGAATATTTATATCTT
TGACCAATACAACACATGGGGTTTCACAAGAGGATGTTCTATGAAGAACCGAGGTAAAAA
TGTGAGAGATGCAATATATGTCATTTCTAGCCAGGCCTACTTGCACTGACAGCAGGCTAG
GTCCTTACATACAAAGTGTTCTTGTGAAAGCATTTCCTATTTTTCTTCTGGTTCCTCTGG
AGGACTATTTAGAGAAAATTCAACAAGTGGATTTTAATATATTCCACCCATCTTTACAGG
AGAAGAATACATTGCTTCCATTATCTTTGTATGTTCAGTCATAGAAAAAAAGATAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
WKA-VKKHNLTKRWLMKIVDEREKN-LDDKAYRNIQELESYAENTQSSLLYLTLEILGI-KDLHADHAASHIGKAQGIVTCLRAMPYHGSRRRVFLPMDI
WKA.VKKHNLTKRWLM...DE.EKN.LDDKAY.NIQELE.YAENTQ.SLLYLT.EILGI..DLH.DH..SH.GKAQGIVTCLRA..Y.GSRRRV..P..I
Retrocopy
WKAAVKKHNLTKRWLMRVIDEGEKN/LDDKAYCNIQELENYAENTQNSLLYLTPEILGI/NDLHEDHVTSHTGKAQGIVTCLRATSYSGSRRRVCPPLNI


Parental protein
CMLHGVSQEDFLR----KNRDKNVRDVIYDIASQAHLHLKHARSFH-KSVPVKAFPAFLQTVALEDYLKKIQQVDFDIFHPSLQQKNTLLPLSLYIRSWR
..........F.R....KNR.KNVRD.IY.I.SQA.LH...ARS.H..SV.VKAFP.FL..V.LEDYL.KIQQVDF.IFHPSLQ.KNTLLPLSLY..S..
Retrocopy
YIFDQYNTWGFTRGCSMKNRGKNVRDAIYVISSQAYLH*QQARSLH\QSVLVKAFPIFL-LVPLEDYLEKIQQVDFNIFHPSLQEKNTLLPLSLYVQS*K


Parental protein
KRY
KRY
Retrocopy
KRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide