RetrogeneDB ID:
retro_ecab_144
Organism:
Horse ( Equus_caballus )
Location:
1:129983112-129985244 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
86.83 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
POLR3E
Parental gene aliases:
No gene alias available
Parental gene description:
polymerase (RNA) III (DNA directed) polypeptide E (80kD) [Source:HGNC Symbol;Acc:30347]

Genomic region (view in browser)





>retro_ecab_144
ATGGCAAATGAAGAGGATGACCCAGTCGTACAGGAGATCGACGTGTACTTGGCCAAAAGT
CTGGCAGAGAAGCTCTATCTGTTTCAGTACCCTGTGCACCCAGCCTCGATGACCTAAGAT
GACATTCTGTACCTCTCAGCCAAGATCAAGCCCAAGCAGCAGAAGGTAGAGCTTGAGATG
GCCGTCGACATCCTGAATCACAACTATTGTCGCAGCAAAGGGGAGCAGATTGCACTGAAT
GTGGGTGGCGCCTGTGCCAATGAGACCAGCACATGTTCCTAGAAGCTGATGGACAGCAGA
CGTTCGGCTCCTCCCAGACCACCAGTAACACGTCCTGTTACGCTGCTGCGCTCTACAGGC
AAGGTGAGCTCCACCTGACACCTTTACATGGCATCCTGCAGCTGCAGCCCAGCTTCTCCT
ACCTGGACAAGGCAGATGCCAAGCACCGAGAGAGGGAGGCAGCCAGTGAGGCGAGAGACT
CTTCACAGGCCAAGGCAGAAGAAGATGTGAAGCAGATCACGGTCCGGTTCTCCCTGCCCG
AGTCGGAACAGGCCTGCCAGCGTCGTGTGCAGTCCTACAAGTTCCTGCAGAAGAAGCATG
TCAGAGAACCCTGGGTCCACCTGCACTACTATGGCCTGAGGGACAACCGCTCTGAGCACG
AGCGCCAGTACCTGCTGTGCCAGGGCTCCAGCGGGGTTGAGAACATGGAGCTCGTCAAGT
TACCGAGTGAGTACCTCATAATGCTGATGCCCCCCCAGCCAGGAGCAGGAGAAAGACAAA
CCTGTGGCCCCCAGCAATGTCCTGTCCAGGGCCCAGCTATGCACCCTGCCTCTGGCTGAT
CAGATCAAGGTCCTGATGAAGAATGTGAAGGTCATGCCTTTTGCCAACTTGATGAATCTC
CTAGGCCCCTCCCTCGACTCTGTGGCTGTTCTGCGTGGCATCCAGAAGGTGGCTATGTTA
GTCCAAGGAAACTGGGTGGTGAAGAGTGGCATCCTGTACCCCAAGGACTCCTCCAGCCCT
CACAGTGGCGTGCCTGCCGAGGTGCTCTGCAGGGGCCGAGACTTTGTTATGTGGAAGTTC
ACGCAGAGCTGGTGGGTGGTAAGGAAAGAGGTGGCAATGGTGACTAAACTCAGTGCAGAG
GATGTGAAGGACTTTCTGGAGCACGTGGCGGTAGTGAGGATCAGCAAAGGCTGGGAGTTC
ATACTGCCTTACGATGGAGAGTTCGTCAAGAAGCATCCGGATGTGGTCCAGTGGCAGCAC
ATGCTGTGGATGGGCATCCAGGCCAAGCCAGAAAAAGTTTATAATTTTGTGAAGGAAACT
ATGCCAAAGAAACCAGATGGACAATCAGGGCCTGCTGGGCTGTTCTCTGGGGACCAGCGG
GTCCAAGTAGCCAAGAGCAAGGCCCAGCAGAACCACGCATTGCTGGAACAGGAGCTGCAG
CGGAGGAAGGAACAGATCCAGGCATCCACGGTCCTGCCTGGTATTCGGATCAAGGAGGAG
CCCATGAGCGAGGAAGGAGAGGAAGAGGAAGAGCGGGAAGTGGAGGAAGACGAGGAGCCC
ATGGACACCTCACCCAGTCATGGCCTCCACAATAGGCTGGCCAGTGGGCTGCCTGCGGGC
AGGCAGCAGGCGGGGACAGCTTCAGCGGGCACCCGCCCCCAGGCTGTGCCAACACCCCTG
TGGCCCAGGAACTGAGGGCCTTCGTGGAGGCCACCTTTCAGAGATAGTTTGTGCTCACAC
TGAGCAAACTCAAGCGTCTCTTCAACCTGCACTTGGTCAGCCTGCCCCATGGCCACATGG
TCTTCAGTGGCATCTTGGACGGCATGCTGCAGGATACGATGCTGGCCGCCGGTTGCAAGC
AGATACTGTTGCCTTTTCCCCCACAGACTGCTGCTTCTTCGGATGAGCAGAAGGTGTTCG
CCCTCTGGGAGTCTGGAGACGTGAGTGGTCAGCATCGACAGGTTTTGCTTGAAATTTTTT
CCAAAAACTACCGGGTACTCCGGAACATGATCCAGTCTTGGTTGACTCAAGAGTGTGGAG
AAGATCTAAGTAAACAGGAGGTGGATAAAGTGCTACAGGGCTGCTGTGTAAGCTGTGGTG
GCATGTGGTACCTTAAAGGGACGGTGCAGTCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.23
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMD-K
MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPV.PASMT.DDI..LSAKIKPKQQKVELEMA.D.LN.NYCRSKGEQIALNV.GACA.ETST.S.KLMD..
Retrocopy
MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPVHPASMT*DDILYLSAKIKPKQQKVELEMAVDILNHNYCRSKGEQIALNVGGACANETSTCS*KLMD/Q


Parental protein
QTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDKADAKHREREAANEAGDSSQDEAEEDVKQITVRFSRPESEQARQRRVQSYEFLQKK
QTF.SSQTTSNTS.YAAALYRQGELHLTPLHGILQL.PSFSYLDKADAKHREREAA.EA.DSSQ..AEEDVKQITVRFS.PESEQA.QRRVQSY.FLQKK
Retrocopy
QTFGSSQTTSNTSCYAAALYRQGELHLTPLHGILQLQPSFSYLDKADAKHREREAASEARDSSQAKAEEDVKQITVRFSLPESEQACQRRVQSYKFLQKK


Parental protein
HAEEPWVHLHYYGLRDSRSEHERQYLLCQGSSGVENTELVKSPSEYLMMLMPP-SQEQEKDKPVAPSNVLSMAQLRTLPLADQIKILMKNVKVMPFANLM
H..EPWVHLHYYGLRD.RSEHERQYLLCQGSSGVEN.ELVK.PSEYL.MLMPP.SQEQEKDKPVAPSNVLS.AQL.TLPLADQIK.LMKNVKVMPFANLM
Retrocopy
HVREPWVHLHYYGLRDNRSEHERQYLLCQGSSGVENMELVKLPSEYLIMLMPP\SQEQEKDKPVAPSNVLSRAQLCTLPLADQIKVLMKNVKVMPFANLM


Parental protein
SLLGPFIDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGVPAEVLCRGRDFVMWKFTQSRWVVRKEVATVTKLSAEDVKDFLEHMAVVRINKGW
.LLGP..DSVAVLRGIQKVAMLVQGNWVVKS.ILYPKDSSSPHSGVPAEVLCRGRDFVMWKFTQS.WVVRKEVA.VTKLSAEDVKDFLEH.AVVRI.KGW
Retrocopy
NLLGPSLDSVAVLRGIQKVAMLVQGNWVVKSGILYPKDSSSPHSGVPAEVLCRGRDFVMWKFTQSWWVVRKEVAMVTKLSAEDVKDFLEHVAVVRISKGW


Parental protein
EFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDGQSGPAVLVSGDQRVQVAKSKAQQNHALLERELQRRKEQIRASTVLPGVRIK
EFILPYDGEF.KKHPDVVQ.QHMLW.GIQAK.EKVYN.VKETMPKKPDGQSGPA.L.SGDQRVQVAKSKAQQNHALLE.ELQRRKEQI.ASTVLPG.RIK
Retrocopy
EFILPYDGEFVKKHPDVVQWQHMLWMGIQAKPEKVYNFVKETMPKKPDGQSGPAGLFSGDQRVQVAKSKAQQNHALLEQELQRRKEQIQASTVLPGIRIK


Parental protein
EEPMSEEGEEEEEREVEEDEEPMDTSPSRGLHNRLANGLPAGR-AAGGDSFNGHPPPGCASTPVARELRAFVEATFQRQFVLTLSELKRLFNLHLASLPP
EEP...................MDTSPS.GLHNRLA.GLPAGR.AAGGDSF.GHPPPGCA.TPVA.ELRAFVEATFQR.FVLTLS.LKRLFNLHL.SLP.
Retrocopy
EEPXXXXXXXXXXXXXXXXXXXMDTSPSHGLHNRLASGLPAGR/AAGGDSFSGHPPPGCANTPVAQELRAFVEATFQR*FVLTLSKLKRLFNLHLVSLPH


Parental protein
GHTLFSGISDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFSKNYRVRRNMIQSRLTQECGEDLSKQEVDKVLKDCCV
GH..FSGI.D.MLQDT.LAAGCKQIL.PFPPQTAAS.DEQKVFALWESGD.S.QHRQVLLEIFSKNYRV.RNMIQS.LTQECGEDLSKQEVDKVL..CCV
Retrocopy
GHMVFSGILDGMLQDTMLAAGCKQILLPFPPQTAASSDEQKVFALWESGDVSGQHRQVLLEIFSKNYRVLRNMIQSWLTQECGEDLSKQEVDKVLQGCCV


Parental protein
SYGGMWYLKGTVQS
S.GGMWYLKGTVQS
Retrocopy
SCGGMWYLKGTVQS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide