RetrogeneDB ID:
retro_ecab_147
Organism:
Horse ( Equus_caballus )
Location:
1:136437928-136439224 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.41 %
Coverage:
99.08 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
TUBAL3
Parental gene aliases:
No gene alias available
Parental gene description:
tubulin, alpha-like 3 [Source:HGNC Symbol;Acc:23534]

Genomic region (view in browser)





>retro_ecab_147
AAGTGCACCTCCATCCAGTTTGGCCAGGCTGGTATCCAGATGGGCAATGCCTGCTGGGAG
CTCTACTGCCAGGAACATGGCATCCAGTCCAACGGCCAGATGCCAAGGGACAAGACCATT
AGGGGAAGAGATAACTCCCTCAACACATTCTTCAGTGACACAGGCATTGACAAGTATGTG
CCCAGAGCAGTGTTTGTAGACCTGGAACCCATGGTCATTGATGAAGTTTGCACTGGCACC
TACCATCAGCTCTTTCACCCTGAACAGCTCATCAGAGGCAAGGAAGATGCTGTCAATAAC
TATGCCCATGGGCACTACACCATTGGTAAGGTGATCATTGACCTTGTCTTGGACCAAATT
TGGAAACTGGCCAGCCAGTGTATGGGTCTTCAGAGCTTCTTGGTTTTCAACAGCTTTGGT
GGGGGAACTGGTTCTGGGCTCACCTCTCTGTTGATGGAATGTCTCTGTCAACTATGGCAA
GAAGTCCAAGCTGGAGTTCTCCATTTACCAAGCCCCCAGGTTTCCACAGGTATAGTTGAG
TGCCACAACTCCATCCTCACCACTTACACCACCCTGGAGCACTGTGATTGTGCCTTTATG
GTAGACAAGGAGGCCATCTATGACATCTGTTGTAGAAGCCTCACTATTGAGTGTCTAACC
TATACTAACCTGAATAGGTTGATAGGTCAAATTGTGTCCTGCATCGCTGCTTCCCTCAGA
TTTGATGTAGCTCTGAATGTTGACCTGACAGAATTCCAGACCAACCTGGTGCCCTATCCC
CGCATCCACTTCCCTCTTGCCCTGTATGCCCCTGTCATCTTTGTTGAGAAAGCCTACCAT
GAATAGCTTTCTGTAGCAGAGATCAGAACGCTTCTTTTGAGCCAGCCAACCAGATGGTGA
AATGTGATCCTTGCCATGGTAAATACACGGCTTGTTGCCTGTTGTACCATGGTGATGTGG
TTCCCAAAGATGTCAATGCTGCTGTTGCCATCATCAAGACCAAGCATACCATCCAGTTTG
TAGATTGGTGCCCCACTGGCTTCAAAGTTGGCATCAATCACCAGCTTCCCACTGTGGTAT
CTGGTGGAGACCTGGCCAAACTACAGTGAAGTGTGTGCATGCTGAGCAATACCACAGCCA
TTGCTGAGGCCTGGGCTAGCCTGGACCACAGCTTGACCTGATGATGCCAAGCGTGTCTTT
ATTCATTGGTACGTGGGTGAGCGCATGGAAGAAGGAGAGTGTTCTGAGGGCTGTGAGGAC
ATGGCTGCCCCTTAGAAGGATTACTAGGAGGTTGGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.05
SRP021940_embryo 0.05
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ECLSIHIGQAGIQIGDACWELYCLEHGIQPDGGL-ENANVEHMDASFDTFFCETRAGKYVPRALFMDLEPTVVDGIRTGKYRSLFHPEQLVSGKEDAANN
.C.SI..GQAGIQ.G.ACWELYC.EHGIQ..G...........D.S..TFF..T...KYVPRA.F.DLEP.V.D...TG.Y..LFHPEQL..GKEDA.NN
Retrocopy
KCTSIQFGQAGIQMGNACWELYCQEHGIQSNGQMPRDKTIRGRDNSLNTFFSDTGIDKYVPRAVFVDLEPMVIDEVCTGTYHQLFHPEQLIRGKEDAVNN


Parental protein
YARGHYSVGSEIIDLVLERIRKLAKQCSGLQGFLIFRSFGGGTGSGFTSLLMEQ-LSIEYSRKTKLEFSVY-PAPRISTAVVEPYNSILTTHSTIEHSDC
YA.GHY..G..IIDLVL..I.KLA.QC.GLQ.FL.F.SF.GG........L.....S..Y..K.KLEFS.Y.P.P..ST..VE..NSILTT..T.EH.DC
Retrocopy
YAHGHYTIGKVIIDLVLDQIWKLASQCMGLQSFLVFNSF-GGGTGSGLTSLLME\VSVNYGKKSKLEFSIY/PSPQVSTGIVECHNSILTTYTTLEHCDC


Parental protein
SFMVDNEAIFDICHRKLGVERPSYASINRLIGQAVSSITASLRFKGPLNVDLIEFQTNLVPYPRIHFPMTTFAPIISADKAYHEELSVSDITA-ACFEFS
.FMVD.EAI.DIC.R.L..E...Y...NRLIGQ.VS.I.ASLRF...LNVDL.EFQTNLVPYPRIHFP....AP.I...KAYHE.LSV..I...A.FE..
Retrocopy
AFMVDKEAIYDICCRSLTIECLTYTNLNRLIGQIVSCIAASLRFDVALNVDLTEFQTNLVPYPRIHFPLALYAPVIFVEKAYHE*LSVAEIRT/ASFEPA


Parental protein
NQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKSRNSVRFVDWCPTGFKVGINNQPPVAMPGGDLAKVQRAVCMLSNTTAIVEAWARLDH-KFDLM
NQ.VKCDP..GKY.ACCLLY.GDVVPKDVNAA.A..K......FVDWCPTGFKVGIN.Q.P....GGDLAK.Q..VCMLSNTTAI.EAWA.LDH...DLM
Retrocopy
NQMVKCDPCHGKYTACCLLYHGDVVPKDVNAAVAIIKTKHTIQFVDWCPTGFKVGINHQLPTVVSGGDLAKLQ*SVCMLSNTTAIAEAWASLDH/QLDLM


Parental protein
Y-AKRAFLHWYIREGMEEGEFSEAREDLAALEKDYEEVG
..AKR.F.HWY..E.MEEGE.SE..ED.AA..KDY.EVG
Retrocopy
M/AKRVFIHWYVGERMEEGECSEGCEDMAAP*KDY*EVG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide