RetrogeneDB ID:
retro_ecab_148
Organism:
Horse ( Equus_caballus )
Location:
1:138424661-138425569 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.99 %
Coverage:
61.37 %
Frameshifts:
6
Stop codons:
6


Parental gene:
Parental gene symbol:
CCT4
Parental gene aliases:
No gene alias available
Parental gene description:
chaperonin containing TCP1, subunit 4 (delta) [Source:HGNC Symbol;Acc:1617]

Genomic region (view in browser)





>retro_ecab_148
GTGGCTAATTCTGACAAAACCAGAGTTGAAAAGACTAAGATTGGGCTTATTCAGTTTAGC
TTATCTGCTCCCAGAACAGATATGGATAATCAAACAGTAATTTCTGATATGCCCGGATGG
ACTGAGCGCTTCGAGAGGAGAGAGCCTGCATTCTATATTTAGTGAACCAAATTTTAAAAA
CAGGATATAGTATGCTTCTCATATAGAAGTCTATTCTTAAGAGAGGCTCTTAGTGATCTT
TCATGACATCTCATTAACAAAATGAAGATGATGGTTAAGGATACGGAAAATGAAGACGTT
GAAGTTGTTTGTAAGACAGTTGGAACCAACCCAGTTGCTCATTTTGACCAATTCACTCCT
GACCTGCTGGGTTTGGCTGAGTTAGCTGAGGGGGTCCATTTAAATGGTTCTGGCAAACTA
CTCAAGGTTACAGGCTGCGCACGCCCTGGAAAAAGTTACAGTTGCTGTTCGTGGTTCTAA
AAAATTGGTGATTGAAGAAGCTGAGCGCTCCATTCACGACGCGTGATGTGTTATTCGCTG
TTTAGTGAAGAGGAGAGCTCTTATTGCATGACATGGTGTGCCAGAACTAGAGTTGGCCCT
GTGGTTAACTGAGTATTCATGAACATTGAGTGGATGGGATCCTGCTGCGTTCGTGCCTTT
GCAGGTGTTATGGAGGTCATTCTACCGACGCTATCTGAAACTGCTGGCCTGAGTCCCGTT
TCTGCAGTAACAGAACTAAGGAACTGGCATGCCCAGAGAGAAAAACTACAGGCATTAATG
TCCAAAAGGATGGTATTTCCAGTGTTTTGGAGGAACTGGTTGTCCAGCCTTTGTTGGTTT
CAGTCAGTGTGCTGACTCTAGCAACTGATACTGTCTGGATCAGTCTGCAAATTGATGATG
TGGTAAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VANSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSD-YVQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSIL-RDALSDLALHFLNKMKIMVVKDIER
VANS..TRVEK.KIGLIQF.LSAP.TDMDNQ.V.SD.Y..MD..LREERA.IL.LV.QI.KTG...LLI.KSIL.R.ALSDL..H..NKMK.MV.KD.E.
Retrocopy
VANSDKTRVEKTKIGLIQFSLSAPRTDMDNQTVISD/YARMD*ALREERACILYLVNQILKTGYSMLLI*KSIL\REALSDLS*HLINKMKMMV-KDTEN


Parental protein
EDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCT-SPGKT-VTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAP
ED.E..CKT.GT.PVAH.DQFT.D.LG.AELAE.V.LNGSGKLLK.TGC...P.K..VT..VRGS.KLVIEEAERSIHDA.CVIRCLVK.RALIA..G.P
Retrocopy
EDVEVVCKTVGTNPVAHFDQFTPDLLGLAELAEGVHLNGSGKLLKVTGCA/TPWKK/VTVAVRGSKKLVIEEAERSIHDA*CVIRCLVKRRALIA*HGVP


Parental protein
EIELALRLTEYSRTLSG-MESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGE-KTTGINVRKGGISNILEELVVQPLLVSVSALTLATETV
E.ELAL.LTEYS.TLSG.M.S.CVRAFA..MEVI..TL.E.AGL.P.S.VTELRN.HAQ.E.KTTGINV.K.GIS..LEELVVQPLLVSVS.LTLAT.TV
Retrocopy
ELELALWLTEYS*TLSG/MGSCCVRAFAGVMEVILPTLSETAGLSPVSAVTELRNWHAQRE/KTTGINVQKDGISSVLEELVVQPLLVSVSVLTLATDTV


Parental protein
RSILKIDDVVN
...L.IDDVVN
Retrocopy
WISLQIDDVVN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide