RetrogeneDB ID:
retro_ecab_150
Organism:
Horse ( Equus_caballus )
Location:
1:139808405-139810515 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
99.57 %
Coverage:
95.91 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
PRKRIR
Parental gene aliases:
No gene alias available
Parental gene description:
protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) [Source:HGNC Symbol;Acc:9440]

Genomic region (view in browser)





>retro_ecab_150
AAACACTTTGAGACCTCTATGATCTGTCGAAACTAGTCCTTATAGGACAGTTCTTCGAGA
TAATGCAATACCAACAATATTTGATCTTACCAGCCATTTGAACAATCCACATAGTAGACA
CAGAAAACGAATAAAAGAATTGAGTGAAGATGAAATCAGGACACTGAAACAGAAAAAAAT
TGATGAAACGTCTGAGCAGGAACAGAAACATAAAGAAATAAACAACAGCAGTGCTCAGAA
GCCCAGTGCAGAAGAGGGAGGTGAAGAACAGGATGAAGACATTTTACCTTTAACCCTTGA
AGAGAAGGAAAACAAAGAATACTTAAAATCTTTATTTGAAATTTTGATTCTTATGGGAAA
ACAAAACATACCTCTGGATGGACATGAAGCTGATGAAATCCCGGAAGGTCTCTTTACTCC
TGATAACTTTCAAGCCCTGCTGGAGTGCCGGATAAATTCTGGTGAGGAGGTTCTGAGAAA
GCGCTTTGAGACAACAGCAGTTAACACGTTGTTCTGTTCGAAAACACAGCAGAAGCAGAT
GTTGGAGATCTGTGAGAGCTGCATCCGGGAAGAAACCCTCAGGGAGGTGAGAGACTCTCA
CTTCTTTTCCATTATCACTGACGATGTCGTGGACATAGCAGGGGAAGAGCACCTGCCTGT
GTTGGTGAGGTTTGTTGATGAATCTCATAACCTGAGAGAGGAATTCGTGGGCTTCCTGCC
TTATGAAGCTGATGCAGAAATTTTGGCTGTGAAATTTCACACTACAATAACTGAGAAGTG
GGGATTAAACATGGAGTATTGCCGTGGTCAGGCTTACATTGTGTCCAGTGGATTTTCTTC
CAAAATGAAAGTTGTTGCTTCTAGACTTTTAGAGAAATATCCCCAAGCCATCTACACACT
CTGCTCTTCCTGTGCCTTAAATATGTGGTTGGCAAAATCTGTGCCTGTTATGGGAGTGTC
TGTTGCATTAGGAACAATTGAGGAAGTTTGTTCCTTTTTCCATCGATCACCACAACTGCT
TTTAGAACTTGACAATGTAATCACTGTCCTCTTTCAGAACAATGAAGAACGGGGTAAAGA
ACTGAAGGAGATTTGCCATTCTCATTGGACAGGCAGGCATGATGCTTTCGAGATTTTAGT
GGACCTCCTCCAGGCACTTGTTTTATGTTTAGATGGTATAAATAGTGACACAAGTATTAG
ATAGAATAACTGTATAGCTGGCCGAGCATTTGTCCTCTGTAGTGCAGTAACAGATTTTGA
TTTCATCGTTACCATTGTTGTTCTTAAAAATGTTCTATCTTTTACAAGAGCCTTTGGGAA
AAATCTCCAGGGGCAAACCTCTGATGTCTTCTTTGCAGCCAGTAGCTTGACTGCAGTGCT
GCATTCACTAAATGAAGTGATGGAAAATATTGAAGTTTATCATGAATTTTGGTTTGAGGA
AGCCACAAATTTGGCAACCAAACTTGATATTCAAATGAAGCTCCCTGGGAAATTCCGCAG
AGCACAGCAAGGTAACCTGGAATCTCAGCTAACCTCTGAGGGTTACTATAAAGAAACTCT
GAGTGTCCCAACAGTGGAACACATTATTCAGGAACTGAAAGATATATTCTCAGAACAGCA
CCTCAAAGCTCTTAAATGCTTATCTCTGGTCCCGTCTGTCATGGGACAGCTCAAGTTCAA
CACGTCAGAGGAGCATCATGCTGACATGTACAGAAGCGACTTACCCAATCCTGACACGCT
CTCGGCCGAGCTGCACTGTTGGAGAATCAAGTGGAAACACAGAGGGAAAGATATAGAGCT
TCCATCCACCATTTATGAAGCCCTCCATCTGCCAGACATCAAGTTTTTTCCTAATGTTTA
TGCACTGCTGAAGGTCCTTTGTATCCTTCCTGTGATGAAGGTTGAGAATGAACGCTATGA
AAACGGGCGGAAGCGTCTCAAAGCATACCTGAGGAACACTTTGACAGACCAAAGGTCGAG
TAACTTGGCTTTGCTTAACATAAATTTTGATATAAAACATGATCTGGATTTAATGGTGGA
CACATATATCAAACTCTATACAGCTAAGTCGGAGCTTCCTACAGAGAATTCAGAAACCAT
TGAGAATACC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KHFETSMICR-TSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKEINNSSAQKPSAEEGGEEQDEDILPLTL
KHFETSMICR.TSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKEINNSSAQKPSAEEGGEEQDEDILPLTL
Retrocopy
KHFETSMICR\TSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKEINNSSAQKPSAEEGGEEQDEDILPLTL


Parental protein
EEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQKQMLEICESCIREETLREVRDS
EEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQKQMLEICESCIREETLREVRDS
Retrocopy
EEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQKQMLEICESCIREETLREVRDS


Parental protein
RFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFVGFLPYEADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYT
.FFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFVGFLPYEADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYT
Retrocopy
HFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFVGFLPYEADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYT


Parental protein
LCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVITVLFQNNEERGKELKEICHSHWTGRHDAFEILVDLLQALVLCLDGINSDTSI
LCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVITVLFQNNEERGKELKEICHSHWTGRHDAFEILVDLLQALVLCLDGINSDTSI
Retrocopy
LCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVITVLFQNNEERGKELKEICHSHWTGRHDAFEILVDLLQALVLCLDGINSDTSI


Parental protein
RWNNCIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFR
R.NNCIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFR
Retrocopy
R*NNCIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFR


Parental protein
RAQQGNLESQLTSEGYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIE
RAQQGNLESQLTSEGYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIE
Retrocopy
RAQQGNLESQLTSEGYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIE


Parental protein
LPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTAKSELPTENSET
LPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTAKSELPTENSET
Retrocopy
LPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTAKSELPTENSET


Parental protein
IENT
IENT
Retrocopy
IENT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide