RetrogeneDB ID:
retro_ecab_152
Organism:
Horse ( Equus_caballus )
Location:
1:159027667-159028328 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.84 %
Coverage:
75.17 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
CCNG1
Parental gene aliases:
No gene alias available
Parental gene description:
cyclin G1 [Source:HGNC Symbol;Acc:1592]

Genomic region (view in browser)





>retro_ecab_152
AAACTGCTCCACCAGCTGAATGCCCTGTTGGAACAGGAGTCCGGATGTCAGCCAGAGGTC
TGTGGCTTGAGACTAATTGAATCTGCACACGATAATGGTCTGAGAATGACTGCAAGGCTC
AGGGAATTTGAAGTAAAAGCTCTTAGTCTAACTCAGTTCTTTGGCTTCAACACAGAGACG
TTTTCTCTAGCTGTGAATTTATTGGAGAGTTTCCTTTCCAAAATGGACGTACCACCCAAG
CAGCTTGGGTGTGTTGGGCTGAGCTGCTTCTATTTGGCTGTAAAATCAATAGAAGAGGAA
AGGAATGTCCCATCGGCAACTGATTTGATCCAAATAAGCCAGTATAGGTTCACGGTTTCA
GACTTGGTGAGAAAGGAAAAGATTGTGTTGGAGAAGGTGTGTTGGAAAGTCAAAGCTGCT
ACTGCCTTTCAATTTCTGCCAACTCTATTATTCACTCACTCAAGGGAATTTGCCATTTGA
AAGGAAGAATGGCCTTAATTTTGAAAGACTAGAAGTTCAACTTAAGGCATGTTACTGCAG
GATCATATTTTCTAAAGCAAAGCTTTCTGTTTTGGCATTGTCTATGACTCCATTGGAGAG
CCAAGCCCAGAAGTGTGTAGATTTAACAGAAGGAGTAGAATGTCTTCAGAAGCATTCCAA
G

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEE
KLLHQLNALLEQES.CQP.VCGLRLIESAHDNGLRMTARLR.FEVK..LSLTQFFGF.TETFSLAVNLL..FLSKM.V.PK.LGCVGLSCFYLAVKSIEE
Retrocopy
KLLHQLNALLEQESGCQPEVCGLRLIESAHDNGLRMTARLREFEVK-ALSLTQFFGFNTETFSLAVNLLESFLSKMDVPPKQLGCVGLSCFYLAVKSIEE


Parental protein
ERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFL-QLYYSLIQENLPFERKNSLNFERLEAQLKACYCRIIFSKAKPSVLALSIIAL
ERNVP.ATDLI.ISQYRFTVSDL.R.EKIVLEKVCWKVKA.TAFQFL.QLYYSL.Q.NLPFERKN.LNFERLE.QLKACYCRIIFSKAK.SVLALS...L
Retrocopy
ERNVPSATDLIQISQYRFTVSDLVRKEKIVLEKVCWKVKAATAFQFL\QLYYSLTQGNLPFERKNGLNFERLEVQLKACYCRIIFSKAKLSVLALSMTPL


Parental protein
EIQAQKCVELTEGVECLQKHSK
E.QAQKCV.LTEGVECLQKHSK
Retrocopy
ESQAQKCVDLTEGVECLQKHSK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide