RetrogeneDB ID:
retro_ecab_156
Organism:
Horse ( Equus_caballus )
Location:
1:13144009-13144264 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
78.82 %
Coverage:
98.84 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FCER1G
Parental gene aliases:
No gene alias available
Parental gene description:
Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [Source:HGNC Symbol;Acc:3611]

Genomic region (view in browser)





>retro_ecab_156
ATGCCAGCAGTGGTCTTGCTCTCACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGAAGAG
CATCAGCTCTGCTGTATCCTGGATGCTATCCTGTTTTTGTGTGGTTTTGTCCTCATCCTG
CTCTACTGTCGACTCAAGAGCCAGGTGCTGAAGGCAGCCATAGCCCCCGATGAGAAATCA
GATGACATTTACACGGGCTTGAGTACCCTGAACCAGGAGACTTATGGGACCCTGCAGCAT
GAGAAACCGCCACAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.7
SRP021940_cerebellum 0.2
SRP021940_embryo 0.02
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAIASYEKSDAVYTGLSTRTQETYETLKHEKPPQ
.PAVVLL.LLLVEQAAAL.E.QLC.ILDAILFL.G.VL.LLYCRLK.QV.KAAIA..EKSD..YTGLST..QETY.TL.HEKPPQ
Retrocopy
MPAVVLLSLLLVEQAAALEEHQLCCILDAILFLCGFVLILLYCRLKSQVLKAAIAPDEKSDDIYTGLSTLNQETYGTLQHEKPPQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide