RetrogeneDB ID:
retro_ecab_160
Organism:
Horse ( Equus_caballus )
Location:
1:52902279-52902658 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.0 %
Coverage:
77.58 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
ALG13
Parental gene aliases:
No gene alias available
Parental gene description:
ALG13, UDP-N-acetylglucosaminyltransferase subunit [Source:HGNC Symbol;Acc:30881]

Genomic region (view in browser)





>retro_ecab_160
CTTGTCCTACAAATAGGTGGAGCGAAGATGGTACCTGAACCACTCAGTACTGAGTCATTA
ACCCTAGATCTTTACAGGTACAAGGATTCATTGAAAGACCTTCAGAAAGCAGATCTTGTT
GTTAGTCACACAGATGCAGGAAGCCATTTGGAGACTCTGGAAAAAAGAAAGCCACTTGTT
GTGGTTATAAATGAAAAGTTGATGAACAATCATCAGCTGGAATTGGCAAAGCAGCTACAC
AAAATGGGCATCTCTTCTACTGAACCTGCAGCACTCGCCAGGGCAGTTACTGTCAGTGGA
CTTATCAACACTGAAATGTTTTCTTCTTGGCCAGCCAGAAAAATTTTTTTCATTTTTGGA
TAAAGTTGTTGGATTACAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LVLQIGRGKVVPEPFSTESFTLDVYRYKDSLKEDLQKADLVISHAGAGSCLETLEKRKPLVVVINEKLMNNHQLELAKQLHK-DGHLFYCTCST-LPGLL
LVLQIG..K.VPEP.STES.TLD.YRYKDSLK.DLQKADLV.SH..AGS.LETLEKRKPLVVVINEKLMNNHQLELAKQLHK..GHLFY.TCST..PG.L
Retrocopy
LVLQIGGAKMVPEPLSTESLTLDLYRYKDSLK-DLQKADLVVSHTDAGSHLETLEKRKPLVVVINEKLMNNHQLELAKQLHK/NGHLFY*TCST/SPGQL


Parental protein
QSMDLSTLKCFPPGQPEKFSAFLDKVVGLQ
.S.DLSTLKCF..GQPEK.....DKVVGLQ
Retrocopy
LSVDLSTLKCFLLGQPEKXXXXXDKVVGLQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide