RetrogeneDB ID:
retro_ecab_161
Organism:
Horse ( Equus_caballus )
Location:
1:52905498-52905753 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.82 %
Coverage:
95.51 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
TIMM9
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of inner mitochondrial membrane 9 homolog (yeast) [Source:HGNC Symbol;Acc:11819]

Genomic region (view in browser)





>retro_ecab_161
ATGGCTGCACAAAGACCAGAATCTGACCAGATAAAACAGTCTAAGTAATTTCTTAGAATC
TACAATAAACTTAGAGAAACCTGCTTTTTGGACTGTGTTCAAGACTTCACAACATCAAAA
GTAAAACCTGAGGAGACCACCTGTTCAGAACATTCCTTACAGAAATATTTTTAAACGATG
CAAAGAATATCCATGAGATTTCAGGAATATCACAGACAGGAGAATGAAGCCCTGGCAGCC
AAATAAGGGCTCGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLL
MAAQ.PESDQIKQ.K.FL..YNKL.ETCFLDCV.DFTT..VKPEETTCSEH.LQKY....QRISMRFQEYH.Q.NEALAAK.GL.
Retrocopy
MAAQRPESDQIKQSK*FLRIYNKLRETCFLDCVQDFTTSKVKPEETTCSEHSLQKYF*TMQRISMRFQEYHRQENEALAAK*GLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide