RetrogeneDB ID:
retro_ecab_164
Organism:
Horse ( Equus_caballus )
Location:
1:60841166-60841589 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.89 %
Coverage:
54.23 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
ENOPH1
Parental gene aliases:
No gene alias available
Parental gene description:
enolase-phosphatase 1 [Source:HGNC Symbol;Acc:24599]

Genomic region (view in browser)





>retro_ecab_164
CTGGACTGAAAGACCATGGTACTGAAACACCTGCAGGGCTACATGTGGAGGGCAGTTTTC
ACAGGTGGATCCATGAAAGCAGCATTTTTTGAAGATGTAGTTCTAGCAGTTAGGAAATGG
AGAGAGGCTGGAATGAAGGTATATATCTATTCTTCAGGGAATGGAGAGGCACAGAAACTG
TTATCTGGGCATTCTTCAGAGGAAGATATTCTTGAGCTTGTTCATAGTTACTTTGATACC
AAGATTGGGCACAAAGTGGAGAGTAAGAGTTATTGAAAGATTGCAGGCAGCACTGGGTAC
TCAGTCAACAGCATCCTGTTTCTGACAGACGTTTCTCTAAAGGCTAGTGCTGCTGAGGAA
GCAGACATTCATGTAGCTGTGGTGGTAACACATGGCAGTGTGGGATTAACAGATGATGGA
AAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.29
SRP021940_cerebellum 0.05
SRP021940_embryo 0.48
SRP021940_placental_villous 0.27
SRP021940_synovial_membrane 0.16
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LDRKTTALKQLQGHMWRAAFTAGRMKAEFFEDVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELFDGHFDTKIGHKVESESYRKIADSIGC
LD.KT..LK.LQG.MWRA.FT.G.MKA.FFEDVV.AVRKWREAGMKVYIYSSG..EAQKLL.GHS.E.DILEL....FDTKIGHKVES.SY.KIA.S.G.
Retrocopy
LD*KTMVLKHLQGYMWRAVFTGGSMKAAFFEDVVLAVRKWREAGMKVYIYSSGNGEAQKLLSGHSSEEDILELVHSYFDTKIGHKVESKSY*KIAGSTGY


Parental protein
STNNILFLTDVTLEASAAEEADVHVAVVVRPGNAGLTDDEK
S.N.ILFLTDV.L.ASAAEEAD.HVAVVV..G..GLTDD.K
Retrocopy
SVNSILFLTDVSLKASAAEEADIHVAVVVTHGSVGLTDDGK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide