RetrogeneDB ID:
retro_ecab_165
Organism:
Horse ( Equus_caballus )
Location:
1:61641334-61642000 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.65 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
ATP6V1E1
Parental gene aliases:
No gene alias available
Parental gene description:
ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 [Source:HGNC Symbol;Acc:857]

Genomic region (view in browser)





>retro_ecab_165
ATGACCCACAGTGATGCTGACATGCAAAAGCAGATTAAGCATATGATAGCTTTTACTGAA
CAAGAAGCCAATGAGAAAGCAAAAGAAATAGATTTGAAAGCAAAAGAATTCAATGATAAG
AAAGGTCTTATTGTACAAACCCAAAGACTGAAGATCATGGAATACTATGAGAAGAAAGAA
AAGCAGATTGAGCAATAGCAGAAAATTCAGATGTCCAATTTGATGAATCAAGCGAGGCTC
AAAGTCCTCAGAGCAAGAGATGACCTTACTACAGACCTACTAAATGAAGCAAAACAGAGA
CTCAGCAAAGTGGTAAAAGATGCAGCCAGGTACCAAGTCCTATTGGTCCTCCAGAGTTCA
TACCAGTTGTGGGAGCCCTGAACGATTGTTCATTGCAGGAGACAGGATTTCCCTCTGGTA
AAGGTTGCAGTGCAAAAAGCAATCCCTATTTACAAAATCACCAACAAAGATGATGTTGAT
GTCCAAACTGATCAGGAGGCCTACCTGCCTGAGAAAATACCTGGTGGAGTTGCGATCTAT
AATGGGGATTGTAAAATAAATGTTTCCAATACCCCGGAAAGCCAGCAGGATCTCATAGCC
CAGCAGATGATGCCAGAAGTACAGTTAGCCTTGTTTGGTGCAAATGCCAACAGAAAATTT
TTGAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.26
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.23
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQ
M..SDAD.QKQIKHM.AF.EQEANEKA.EID.KA.E.FN..KG..VQTQRLKIMEYYEKKEKQIEQ..KIQMSNLMNQARLKVLRARDDL.TDLLNEAKQ
Retrocopy
MTHSDADMQKQIKHMIAFTEQEANEKAKEIDLKAKE-FNDKKGLIVQTQRLKIMEYYEKKEKQIEQ*QKIQMSNLMNQARLKVLRARDDLTTDLLNEAKQ


Parental protein
RLSKVVKDTARYQVLLDGLVLQGLYQLLEPRMIVRCKKQDFPLVKAAVQKAIPMYKIATKRDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVCNTLESRL
RLSKVVKD.ARYQVL...LVLQ..YQL.EP..IV.C..QDFPLVK.AVQKAIP.YKI..K.DVDVQ.DQEAYLPE.I.GGV.IYNGD.KI.V.NT.ES..
Retrocopy
RLSKVVKDAARYQVL---LVLQSSYQLWEP*TIVHCRRQDFPLVKVAVQKAIPIYKITNKDDVDVQTDQEAYLPEKIPGGVAIYNGDCKINVSNTPESQQ


Parental protein
DLIAQQMMPEVRGALFGANANRKFLD
DLIAQQMMPEV..ALFGANANRKFL.
Retrocopy
DLIAQQMMPEVQLALFGANANRKFLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide