RetrogeneDB ID:
retro_ecab_175
Organism:
Horse ( Equus_caballus )
Location:
1:82330334-82330730 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.32 %
Coverage:
53.2 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS6
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S6 [Source:HGNC Symbol;Acc:10429]

Genomic region (view in browser)





>retro_ecab_175
GGGCAGGGGGAGATTTCTGGATGGATTGATACTGCCATGCCTGTGGCCTGAGGCCCAAAA
GAGCTGGAAGAATCTGCAAACTTTCAATCTCCTAAAGAAGATGATGCCCACCAGTGTGTT
GTGAGAAAGCCCCTGAACAAAGAAGGTAAGAAACCCAGAACCAAAGCGCCCAAGATTCAG
CGTCCTGTTACTCCACCTGTCCTGCAACATACATGTCAGCATATTGCCCTGAAGAAACAG
CATACTCAGAAAAATAAAGAAGGGCACACAAAATATGCTCAACTTTAGGCCAAGAGAATG
AAGGAGGCCAAAGAAAAATGCCAGGAGCAGATTGCCAAGAGATGGAGGCTGTCGTCTCTG
AGAGCTTCCGCCTCTGAGTCTGAGTCCGGTCAAAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GEKDIPGLTDTTVPRRLGPK-RASRIRKL-FNL-SKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLL
G...I.G..DT..P...GPK.RA.RI.KL.FNL..KEDD..Q.VVRKPLNKEGKKPRTKAPKIQR.VTP.VLQH....IALKKQ.T.KNKE....YA.L.
Retrocopy
GQGEISGWIDTAMPVA*GPK/RAGRICKL/FNL/PKEDDAHQCVVRKPLNKEGKKPRTKAPKIQRPVTPPVLQHTCQHIALKKQHTQKNKEGHTKYAQL*


Parental protein
AKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK
AKRMKEAKEK.QEQIAKR.RLSSLRAS.S.SES.QK
Retrocopy
AKRMKEAKEKCQEQIAKRWRLSSLRASASESESGQK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide