RetrogeneDB ID:
retro_ecab_179
Organism:
Horse ( Equus_caballus )
Location:
1:104002470-104002992 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
91.95 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SPRYD7
Parental gene aliases:
No gene alias available
Parental gene description:
SPRY domain containing 7 [Source:HGNC Symbol;Acc:14297]

Genomic region (view in browser)





>retro_ecab_179
AAGGAGATGCCGGCCATGCAGCTGGATACGCAGCACATGGGAGCAGATGTTGTCATTGTG
AAAAATGGGAGAAGAATATGTGGAACAGGAGGTTGTTTAGCCAGTGTGCCTTTACATCAA
AACAAAAGCTACTTTGAATTCAAAATCCAGTCCACAGGAATCTGGGGTATTGGCGTTGCA
ACTCAGAAAGTTAACTTGAATCAGATTCCTCTTGGCCAAGATGTGCACAGTCTGGTGATG
AGAAATGATGGGGCCCTGTACCACAACAACGAGGAGAAAAATAGGCTGCCAGCAAACAGC
CTTCCACAGGAGGGAGACCTAGTGGGTATTACATATGACCAGGTAGAATTAAATGTGTAT
TTGAATGGAAAAAACATGCCTTGTCCAGCATCAGGCATACGAGGGACAATGTATCCAGTT
GTTTATGTTGATGACAGTGCAATTTTGGATTGCCAGTTCAGTGAATTTTATCATATTCCT
CCGCCTGGTTTTGAAAAAATATCATTTGAACAGCAAATCTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.6
SRP021940_embryo 0.1
SRP021940_placental_villous 0.76
SRP021940_synovial_membrane 0.26
SRP021940_testis 0.42

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
REMPAVQLDTQHIGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGVGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPANS
.EMPA.QLDTQH.G.DVVIVKNGRRICGTGGCLAS.PLHQNKSYFEFKIQSTGIWG.GVATQKVNLNQIPLG.DVHSLVMRNDGALYHNNEEKNRLPANS
Retrocopy
KEMPAMQLDTQHMGADVVIVKNGRRICGTGGCLASVPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGQDVHSLVMRNDGALYHNNEEKNRLPANS


Parental protein
LPQEGDVVGITYDHVELNVYLNGKNMHCPASGVRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
LPQEGD.VGITYD.VELNVYLNGKNM.CPASG.RGT.YPVVYVDDSAILDCQFSEFYH.PPPGFEKI.FEQQIF
Retrocopy
LPQEGDLVGITYDQVELNVYLNGKNMPCPASGIRGTMYPVVYVDDSAILDCQFSEFYHIPPPGFEKISFEQQIF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide