RetrogeneDB ID:
retro_ecab_18
Organism:
Horse ( Equus_caballus )
Location:
1:161222216-161223005 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.85 %
Coverage:
70.65 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PSMB8
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, beta type, 8 [Source:HGNC Symbol;Acc:9545]

Genomic region (view in browser)





>retro_ecab_18
ATGGCTCTGCAGGATGTATGCAAGTGGCAGGCCCCGGACACCCAGGGATTGTCACCTCAC
CTGCCTCAGGCTGGTGGCTGGGCTGTGCCCCGGGGCTGTGACCCTCAAACCTTCTTGCAG
ATCCACGGCCCCAGGCTGGCCCACGGCACCACCACCCTGGCCTTCCGCTTCCGTCACGGA
GTCATTGCTGCAGCTGACACGCGTTCCTCCTGTGGCAACTATGTGGCCTGTCCAGCCTCA
CGCAAGGTCATCCCTGTGCACCAGCACCTCCTGAGCACCACCTCTGGCACCTCCGCCGAC
TGTGCCACATGGTACCGGGTGCTACAGCGGGAGCTGCGGCTGCGGGCACTGAGGGAGGGG
CAGCTGCCCAGTGTGGCCAGTGCCGCCAAACTCTTGTCAGCCATGATGTCCCACTACCGG
GGGCTGGATCTGTGTGTGGCCACTGCCCTGTGTGGCTGGGACCGCTCTGGCCCGGCCCTC
TTCTATGTCTACAGCGATGGCACCCGCCTGCAGGGGGACATCTTCTCGGTGGGCTCTGGA
TCTCCCTATGCCTATGGCGTGCTGGACCGCGGCTACCGCTACGACATGACCACCCAGGAA
GCCTACGCCCTGGCTCGCTGCGCCGTGGCCCATGCCACCCACCGTGATGCTTACTCTGGG
GGTTCTGTAGACCTTTTTCACGTGCGAGAGAGTGGATGGGAGTATGTGTCGCGCAATGAT
GCCTGGGTGCTCTACTCTGAGCTGCAGAAACTCCCAGAGCCAGAGAAGGAAGAGGAGGAG
GAGGCCAGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAHGTTTLAFKFQHGVIVAVDSRASAGSYIATLRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLS
.AHGTTTLAF.F.HGVI.A.D.R.S.G.Y.A.....KVI.....LL.T.SG..ADC..W.R.L..E.RL..LR.G...SV..A.KLLS.MM..YRG..L.
Retrocopy
LAHGTTTLAFRFRHGVIAAADTRSSCGNYVACPASRKVIPVHQHLLSTTSGTSADCATWYRVLQRELRLRALREGQLPSVASAAKLLSAMMSHYRGLDLC


Parental protein
MGSMICGWDKKGPGLYYVDENGTRLSGNMFSTGSGNSYAYGVMDSGYRNNLSIEEAYDLGRRAIVHATHRDSYSGGVVNMYHMKEDGWVKVESTD
.....CGWD..GP.L.YV...GTRL.G..FS.GSG..YAYGV.D.GYR......EAY.L.R.A..HATHRD.YSGG.V...H..E.GW..V...D
Retrocopy
VATALCGWDRSGPALFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMTTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEYVSRND


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide