RetrogeneDB ID:
retro_ecab_184
Organism:
Horse ( Equus_caballus )
Location:
1:115917239-115917665 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
51.68 %
Coverage:
67.28 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
ZCRB1
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger CCHC-type and RNA binding motif 1 [Source:HGNC Symbol;Acc:29620]

Genomic region (view in browser)





>retro_ecab_184
ATCATAAAGTTTACTGTTAGAAAAAAAGATGCTGAGAAGAGTAAAGGGGTTGGGTTTATT
TATTTATTTTTTTGGATAGGAATCTGAATAAAACTATACCAGCCATTAAACAGCAGTTAC
TTGGTTGTGTAATAAAAGCAAGCATTGCTACTGACAACTGAAGAGCAGCTGAATTCATCT
GAAGGTAAAACTGCTTTGATAAATCTAATGAATGTAGGGAAGCGGACCCTTGTGTTATAC
CTGTCTTGAAAATATGCATAGAGAATGTGAACTACCACAAAAGAAAGAGAAAAAGAAAAA
AGAGAAAATCTCAGATCCTGAAGAAGAAAGTGAGGAAGTAGAAGAAAGTGAAGATGAAGG
GGAAAACCCTGCATTTGGCACCTCAGCCAGGTTGTAGCTTTCCAGCAAACCAACACTGAA
AAAGAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.17
SRP021940_placental_villous 0.31
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VVKVTIMKDKDTRRSKGVAFI-LFLDKDSAQNCTRAINNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGE-SGHLSYACPKNMLGEREPPKK
..K.T..K.KD...SKGV.FI.LF...D...N.T......QL.G.VIKASIA.DN.RAAEFI.R.N.FDKS...EC.E.SG.L.Y.C..NM..E.E.P..
Retrocopy
IIKFTVRK-KDAEKSKGVGFI/LFIFLDRNLNKTIPAIKQQLLGCVIKASIATDN*RAAEFI*R*NCFDKSN--ECRE/SGPLCYTCLENMHRECELPXX


Parental protein
KEKKKKKKIPEPEEEIEGVEESEDEGEDPALDS-LSQAIAFQQAKIEEE
...........PEEE.E.VEESEDEGE.PA....LSQ..AFQQ...E..
Retrocopy
XXXXXXXXXSDPEEESEEVEESEDEGENPAFGT/LSQVVAFQQTNTEKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide