RetrogeneDB ID:
retro_ecab_185
Organism:
Horse ( Equus_caballus )
Location:
1:118997641-118998597 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
89.69 %
Coverage:
83.95 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
ARPC1A
Parental gene aliases:
No gene alias available
Parental gene description:
actin related protein 2/3 complex, subunit 1A, 41kDa [Source:HGNC Symbol;Acc:703]

Genomic region (view in browser)





>retro_ecab_185
AACAGACACATCACAGGCATCAACTGGGCTCCCAAGAGCGACCACATTGTCACTTGCGGG
GCAGACCGCAATGCCTATGTCTGGAGTCAGAAAGATGGTGTTTGGAAGCCAACACTGGTG
ATCCTGCGAATTGATGTTGCAGCCACTTTTGTCAAGTGGTCCCCTCTAGAGAACAAATTT
GCTGTAGGAAGTGGAGCACGGCTCATTTCTATTTGTTACTTCGAGTCTGAAAATGACTTG
TGGGTAAGCAAGCACATTAAAAAGCCAGTTCATTCCACGGTCCTCAGCTTGGATTGGCAT
CCCAACAATGTCTTGCTGGCAGCAGGATCCTATGATTTCAAATGCAGAGTGTTTTCTGCC
TACATTAAAAAAGTATATGAAAAGCCAGCCGTACCCCCTGGGGCAGCAAGATGCCTTTTG
GTCAGCTGATGTCAGAGTTTGGTGGCAGTGGCACTGGTGGCTGTGTGCACGGGGTCAGGT
TTTCCGCCAGTGGGAGCCGCCTGGCCTGGGTCAGCCACGATAGCACCGCATCTGTTGCTG
ATGCCTCAAAAAGCGTACAGATCTCAACTCTAAAGACAGAGTTCCTGCCCCTCCTGAGTG
TATCATTTGTTTCGGAGAATAGCGTTGCAGCTGCTGGCCATGACTCCTGCCCAATGCTCT
TTAACTACTATGACCGTGGTTGCTTGACCTTCTTCTCCAAGCTAGACATTCCAAAACAGA
GCATCCAGCACCACGTGTCTGCCATGGAACACTTCTGCAACGTGGACCAGAGGGCCACAA
CTGAGGACCGCAACACAGCCTTGGAGACGCTGCACCAGAACAGCATCACTCAAGTGTCTA
TTAATGAGGTGGACAAGCAAGATTGTCGCAAATTTTGCATGACTGGCATCGATGGAGCCA
TGATAATTTGGAATTTCAAGACCTTAGAGTCTTCTATCCAGGGCCTTCGGATAATG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.07
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWH
N.HITGI.WAPKSD.IVTCGADRNAYVWSQKDGVWKPTLVILRI..AATFVKWSPLENKFAVGSGARLIS.CYFESEND.WVSKHIKKP..STVLSLDWH
Retrocopy
NRHITGINWAPKSDHIVTCGADRNAYVWSQKDGVWKPTLVILRIDVAATFVKWSPLENKFAVGSGARLISICYFESENDLWVSKHIKKPVHSTVLSLDWH


Parental protein
PNNVLLAAGSCDFKCRVFSAYIKEVDEKPA-STPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLL
PNNVLLAAGS.DFKCRVFSAYIK.V.EKPA..TPWGSKMPFGQLMSEFGGSGTGG.VHGV.FSASGSRLAWVSHDST.SVADASKSVQ.STLKTEFLPLL
Retrocopy
PNNVLLAAGSYDFKCRVFSAYIKKVYEKPA/RTPWGSKMPFGQLMSEFGGSGTGGCVHGVRFSASGSRLAWVSHDSTASVADASKSVQISTLKTEFLPLL


Parental protein
SVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG
SVSFVSENSV.AAGHD.CPMLFNY.DRGCLTF.SKLDIPKQSIQ...SAME.F.N.D.RATTEDRNTALETLHQNSITQVSI.EVDKQDCRKFC.TGIDG
Retrocopy
SVSFVSENSVAAAGHDSCPMLFNYYDRGCLTFFSKLDIPKQSIQHHVSAMEHFCNVDQRATTEDRNTALETLHQNSITQVSINEVDKQDCRKFCMTGIDG


Parental protein
AMTIWDFKTLESSIQGLRIM
AM.IW.FKTLESSIQGLRIM
Retrocopy
AMIIWNFKTLESSIQGLRIM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide