RetrogeneDB ID:
retro_ecab_19
Organism:
Horse ( Equus_caballus )
Location:
1:42306179-42307928 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.97 %
Coverage:
84.75 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CSTF2
Parental gene aliases:
No gene alias available
Parental gene description:
cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa [Source:HGNC Symbol;Acc:2484]

Genomic region (view in browser)





>retro_ecab_19
GAGGTTGGTTCTGTTGTCAGTTTCCGGCTGGTATACGATCGAGAGACGGGAAAACCCAAG
GGGTATGGCTTCTGCGAGTATCAAGACCAGGAGACCGCGCTTAGTGCCATGCGGAACCTT
AATGGGCGGGAGTTCAGCGGGAGAGCGCTTCGGGTGGACAATGCTGCCAGTGAAAAGAAC
AAGGAGGAGTTAAAGAGCCTAGGGCCTGCAGCGCCCATCATTGACTCCCCCTACGGGGAC
CCCATCGATCCGGAAGATGCCCCAGAATCAATTACCAGGGCAGTTGCTAGTCTCCCCCCG
GAGCAAATGTTTGAGCTGATGAAGCAGATGAAGCTGTGTGTCCAAAACAGTCACCAGGAA
GCTCGAAACATGTTACTTCAAAACCCCCAACTGGCTTACGCCCTGTTACAGGCGCAAGTA
GTGATGAGGATCATGGATCCAGAGATTGCTTTGAAAATTCTGCATCGCAAGATACATGTC
ACACCGCTCATCCCAGGCAAATCTCAGCCTGTCTCTGGCCCTGGCCCTGGGATCTGCCCA
GGACCTAATGTTCTACTGAACCAGCAGAATCCTCCAGCCCCTCAGCCTCAGCATTTGGCT
AGAAGACCTGTGAAAGACATCCCTCCTCTGATGCAGACCCCTATCCAGGGTGGAATTCCA
GCCCCAGGGCCAATACCAACTGGGGTTCCCGGACCTGGTCCTGGTTCCTTAACTCCTGGT
GGAGCAATGCAGCCCCAAGTTGGAATGCCAGGGGTTGGTCCTGTGCCTTTAGAGCGGGGA
CAGGTGCAGATGTCGGATCCTAGAGCTCCTATGCCTCGTGGACCCATGACTGCTGGTGGC
CTGCCTCCTCGAGGACTGTTAGGAGATGCACCAAATGACCCACGTGGAGGGACTTTGCTC
TCAGTCACTGGAGAAGTAGAGCCCAGAGGCTATCTTGGCCCACCTCATCAGGGTCCCCCT
ATGCACCATGCCTCTGGTCATGACAGCCGTGGCCCTTCCTCACATGAGATGAGGGGAGGG
CCATTAGCAGATCCCAGAATGCTAATTGGAGAGCCCAGAGGACCCATGATGGATCAAAGG
GGTCTACCTTTGGATGGTAGAGGTAGTAGAGATTCTCGAGGGATGGAGACTCGAGCCATG
GAAACTGAGGTCTTAGAGACACGAGTAATGGAGAGAAGAGGAATGGAGACCTGTGCAATG
GAAGCCAGAGGGATGGAAGCAAGAGGCATGGATGCAAGAGGAATGGAGATAAGGGGCCCT
GGCCCCAGTTCGAGAGGCCCTATGACTGGTGGAATCCAGGGTCCTGGTCCCATTAATATG
GGGGCAGGTGGTCCTCAGGGACCCAGACAGGTCCCAAGCATTTCAGGGGTGGGAAATCCT
GGAGCTGGCATGCAGGGGGCAGGCATACAAGGAGCAGGCATGCAGGGAGCGGGCATGCAG
GGATCGGGCATGCAGGGAGCAGGCATGCAGGGAGCGGGCATGCAGGGAGCGGGCATACAA
GGAGTGGGCATGCAGGGGGCCGGCATACAAGGAACGGGCATGCAGGGGGCGGGCAAGCAA
GGTGGAGGCCAGCCTAGCAGTTTTAGTCCTGGGCAGAGCCAAGTAACTCCCCAGGATCAA
GAAAAGGCAGCTTTGATCATGCAGGTTCTTCAACTGACTGCAGATCAGATTGCCATGCTG
CCTCCTGAGCAAAGGCAGAGCATCCTGATTTTAAAGGAACAAATCCAGAAGTCTACTGGA
GCTTCTTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 28.86
SRP021940_cerebellum 41.37
SRP021940_embryo 58.31
SRP021940_placental_villous 18.69
SRP021940_synovial_membrane 22.32
SRP021940_testis 62.66

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EVGPVVSYLLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPP
EVG.VVS..LVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLG..AP.I.SPYG..I.PEDAPESI..AVASLPP
Retrocopy
EVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPIDPEDAPESITRAVASLPP


Parental protein
EQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHSTGPG--SGSNVSMNQQNPQAPQAQSLG
EQMFELMKQMKLCVQNS.QEARNMLLQNPQLAYALLQAQVVMRI.DPEIALKILHR......LI.G..QPV...GPG...G.NV..NQQNP.APQ.Q.L.
Retrocopy
EQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHRKIHVTPLIPGKSQPVSGPGPGICPGPNVLLNQQNPPAPQPQHLA


Parental protein
GMHVNGAPPLMQASMQAGVPTPGQMPASVTGPGPGALAPGGGMQAQVGMPGSGPVSMERGQVPMQDPRAAMQRGPLPANVPTPRGLLGDAPNDPRGGTLL
...V...PPLMQ...Q.G.P.PG..P..V.GPGPG.L.PGG.MQ.QVGMPG.GPV..ERGQV.M.DPRA.M.RGP..A....PRGLLGDAPNDPRGGTLL
Retrocopy
RRPVKDIPPLMQTPIQGGIPAPGPIPTGVPGPGPGSLTPGGAMQPQVGMPGVGPVPLERGQVQMSDPRAPMPRGPMTAGGLPPRGLLGDAPNDPRGGTLL


Parental protein
SVTGEVEPRGYLGPPHQGPPMHHVPGHDSRGPPPHEMRGGPLAEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGMDARGMEARAMEARGLDARGLEARAM
SVTGEVEPRGYLGPPHQGPPMHH..GHDSRGP..HEMRGGPLA.PR.L..EPRGPM.DQRG.PLDGRG.RD.RGM..R.ME....E.R....RG.E..AM
Retrocopy
SVTGEVEPRGYLGPPHQGPPMHHASGHDSRGPSSHEMRGGPLADPRMLIGEPRGPMMDQRGLPLDGRGSRDSRGMETRAMETEVLETRVMERRGMETCAM


Parental protein
EARAMEARAMEARAMEARAMEVRGMEARSMDTRGPVPGPRGPIPSGIQGPSPI-NMGAVG-PQGSRQVPVMQGAAMQGASIQGGGQPGGFSPG
EAR.MEAR.M.AR.ME.R...............GP..GP......G.QGP........VG.P....Q....QGA.MQGA..QG.G..G....G
Retrocopy
EARGMEARGMDARGMEIRGPGPSSRGPMTGGIQGP--GPINMGAGGPQGPRQVPSISGVGNPGAGMQGAGIQGAGMQGAGMQGSGMQGAGMQG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide