RetrogeneDB ID:
retro_ecab_193
Organism:
Horse ( Equus_caballus )
Location:
1:151517007-151517488 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.73 %
Coverage:
54.24 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
RPSA
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_193
ACTGATCCCACGGCTGACCGCCAGCTTCGCACAGGGGCACCTTATGTTAACCTGCCCACC
ATCTCAGTGTGTAACACAGACACTGCTCAGTGCTACGCGGGTATTGTCATCCCGGGCCAC
AACCGGGGAGCTCGCTCAGTTAGGTGTGAAGTAGGGGTTGCTGGCTAGGGAAGTTCTGCG
CATGCGCAGCTCCATGTCCCGTGAGCATTCGGGAGAGGTCATGCGTGATCTCCTTCTACA
GAGCTCCCGAAGAGAGGAAAAGGAAGAGTAGGCTGCTGCTGAAAAGGCTGCCACCAAGGA
GGAATTCCAGAGTGAATGGACCCCTCCGGCTCCCAAGTTCACTGCTTCTTAACCTGAGGT
CGCAGCCGGGTCAGGTGGCACGTAGGTGCCCTCTGTGTCTATTCAGCGGTTGCCTCCTGC
GGACCGGATGGAGCCTCAGCCTGTCACTGAGGACTGGTCTGCAGCTCCTACTGCTCGGGC
C

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 1.78

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSV-GLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVT
TDP.AD.Q..T.A.YVNLPTI..CNTD....Y..I.IP..N.GA.SV.G.....LAREVLRMR...SREH..EVM.DL.......E.EKEE.AAAEKA.T
Retrocopy
TDPTADRQLRTGAPYVNLPTISVCNTDTAQCYAGIVIPGHNRGARSV\GVK*GLLAREVLRMRSSMSREHSGEVMRDLLLQSSRRE-EKEE*AAAEKAAT


Parental protein
KEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTED-WSAQPATEDWSAAPTAQA
KEEFQ.EWT.PAP.FTA..PEVA..S.G..VPSV.IQ..P..D....QP.TEDWSAAPTA.A
Retrocopy
KEEFQSEWTPPAPKFTAS*PEVAAGSGGT*VPSVSIQRLPPADRMEPQPVTEDWSAAPTARA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide