RetrogeneDB ID:
retro_ecab_194
Organism:
Horse ( Equus_caballus )
Location:
1:158412232-158412893 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.86 %
Coverage:
82.53 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_194
GTAGGAGATGGAGAGACTGTGGAGTTGGATGTTGTTGAAGAGAAAACAGTATGGAGGCAG
CAAATGTTACAGGCCAAGGTGGAGTTCCAGTGCAAGGTTGTAGATATGCAGCAGACCATA
ACCATTATAGATGCTACCCACATTGTGGGTTTCCTCCACACAATTACCAGAATTATCAGA
ACAGTGAGAATAGGGAAAATAATAGAGGATGGGAGAGTGCTTCTGAAGGCCAGGCCCAAT
AGCACCAACCTTGACTCAGGCCACAGTTTTCACCTTAGTACATGCAAAGAGCCTATGAGC
TTCAACCACAGTATTCCAACCCTCTAGTGCAGGAAGAAGTGATGGAGATTGCTGACACCT
AGGGTACAAGAAAGCAAAGTAGACCAGTGAGACAGAATATGTATCATGGTTGTAGACCAG
AGTTCCTCAGGGCCCTCCTCAACAAGAAAAGCATAGACAGGATAGCAATGAATAGGAGGA
GGAAAATAAAGGAGATGAGACCCAAGGTCAGCAGCCACCTCAACGTGGGTACCACTCAAA
CTTCAATTACCTCTGCAGATGTTCAGAAAACCCTAAACCACAATATGGCAAAGAGACAAA
AGCTGCTGATCCACCAGCTGAAAATTCTTCTGCTGCTGAGGCTGAGCAAGGCTGGCCTGA
G

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VGDGETVEFDVVEG-EKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRP
VGDGETVE.DVVE..E...EAANVTG.GGVPVQG..YAAD.NHYR.YP....PP.NYQ.NYQNSE..E.N.G.ESA.EGQAQ...P..R..F.P.YM.R.
Retrocopy
VGDGETVELDVVEE/ENSMEAANVTGQGGVPVQGCRYAADHNHYRCYPHCGFPPHNYQ-NYQNSENRENNRGWESASEGQAQ*HQP*LRPQFSP*YMQRA


Parental protein
YGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRR-GPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
Y...PQYSNP.VQ.EVME.AD..G...Q.RPVRQNMY.G.RP.F.R.GPP.Q...R.D.NE...EN.GDETQGQQPPQR.Y..NFNY..R..ENPKPQ.G
Retrocopy
YELQPQYSNPLVQEEVMEIADT*GTRKQSRPVRQNMYHGCRPEFLR/GPPQQEKHRQDSNE*EEENKGDETQGQQPPQRGYHSNFNYLCRCSENPKPQYG


Parental protein
KETKAADPPAENSSAPEAEQGGAE
KETKAADPPAENSSA.EAEQG..E
Retrocopy
KETKAADPPAENSSAAEAEQGWPE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide