RetrogeneDB ID:
retro_ecab_2
Organism:
Horse ( Equus_caballus )
Location:
X:71435901-71437050 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.4 %
Coverage:
55.15 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PABPC4
Parental gene aliases:
No gene alias available
Parental gene description:
poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:HGNC Symbol;Acc:8557]

Genomic region (view in browser)





>retro_ecab_2
ATGGGGAGTGGGGAGCCTAATCCTGCTGGCAAGAAGAAGAAGTACCTCAAGGCTGCCCTG
TACGTGGGTGACTTGGACCCAGATGTCACCGAGGACATGTTATATAAAAAGTTCAGGCCT
GCTGGCCCTCTGCGCTTCACCCGAATCTGCCGTGACCCGGTGACCCGCAGCCCCCTGGGC
TATGGCTATGTCAACTTTCGCTTTCCTGCGGATGCTGAGTGGGCTCTGAACACCATGAAT
TTTGATTTGATTAATGGCAAACCATTCCGCCTCATGTGGTCTCAGCCAGATGACCGCTTA
AGAAAGTCTGGGGTTGGAAATATATTCATCAAAAATCTGGACAAATCCATAGACAATAGG
GCCCTTTTTTATTTATTTTCTGCTTTTGGGAACATTCTCTCCTGCAAAGTCGTATGTGAT
GACAACGGCTCTAAAGGTTATGCCTATGTGCACTTTGACAGTCTGGCGGCTGCCAATAGG
GCCATCTGGCATATGAATGGAGTGCGGCTCAACAACCGCCAGGTGTATGTTGGCCGATTC
AAATTTCCGGAAGAGCGGGCAGCTGAAGTCAGAACCAGAGATAGAGCAACTTTCACCAAT
GTTTTCGTTAAAAATTTTGGAGATGACATGGATGACGAAAAACTGAAGGAAATTTTCAGT
GAATATGGGTCAACTGAGAGTGTGAAGGTAATAAGAGATGCCAGTGGGAAATCTAAAGGC
TTTGGATTTGTGAGATATGAGACACATGAGGCTGCCCAAAAGGCTGTGTTAGACCTGCAT
GGAAAGTCCATCGATGGAAAAGTCCTATATGTAGGGCGAGCACAGAAGAAAATTGAACGT
CTGGCTGAGTTAAGGCGAAGATTTGAACGGCTGAGATTAAAGGAAAAAAGTCGGGCTCCG
GGAGTGCCTATCTATATTAAGAACCTGGATGAGACCATTGATGATGAAAAACTGAAGGAG
GAATTTTCTTCCTTTGGATCAATTAGCCGGGCCAAAGTGATGGTGGAAGTGGGGCAAGGC
AAAGGGTTTGGTGTTGTCTGCTTCTCCTCTTTCGAGGAGGCTACCAAAGCAGTGGATGAG
ATGAATGGTCGCATAATGGGCTCCAAGCCCCTGCATGTCACCCTGGGCCAGGCCAGGCGT
AGGTGGTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 2.29
SRP021940_embryo 3.71
SRP021940_placental_villous 0.49
SRP021940_synovial_membrane 1.02
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLD
Y..A.LYVGDL..DVTE.MLY.KF.PAGP....R.CRD..TR..LGY.YVNF..PADAE.AL.TMNFD.I.GKP.R.MWSQ.D..LRKSGVGN.FIKNLD
Retrocopy
YLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLD


Parental protein
KSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE-FTNVYIKNFGEEVDDES
KSIDN.AL...FSAFGNILSCKVVCD.NGSKGYA.VHF....AA..AI..MNG..LN.R.V.VGRFK...ER.AE........FTNV..KNFG...DDE.
Retrocopy
KSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNFGDDMDDEK


Parental protein
LKELFSQFGKTLSVKVMRDPSGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKVIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTID
LKE.FS..G.T.SVKV.RD.SGKSKGFGFV.YE.HE.A.KAV....GK.I.GKV..VGRAQKK.ER.AEL.R.FE.L.....SR..GV..YIKNLD.TID
Retrocopy
LKEIFSEYGSTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRAPGVPIYIKNLDETID


Parental protein
DEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRK
DEKL..EFS.FGSI..AKVM.E.G..KGFG.VCFSS.EEATKAV.EMNGRI.GSKPL.V.L.Q..
Retrocopy
DEKLKEEFSSFGSISRAKVMVEVGQGKGFGVVCFSSFEEATKAVDEMNGRIMGSKPLHVTLGQAR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide