RetrogeneDB ID:
retro_ecab_202
Organism:
Horse ( Equus_caballus )
Location:
1:179400431-179400926 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.07 %
Coverage:
68.98 %
Frameshifts:
5
Stop codons:
1


Parental gene:
Parental gene symbol:
YWHAZ
Parental gene aliases:
No gene alias available
Parental gene description:
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:HGNC Symbol;Acc:12855]

Genomic region (view in browser)





>retro_ecab_202
TCTGCAACTGAGCAAGGGGCTGAATTATCCAAAGAGGAGAGAAGTCTCTCGGTTGCTTAT
AAAAACCTTGCAGGAGCCCATAGGTCATCTTGGAAGATCATCCCAAGTATTGAGCAAATG
AGACAAGATGCTAGGAAAAAGAGCAGATGGCTTGAGAATACAGAGAGGAAATGGAAAGTG
ACCTCAGAGATATCTGCAAAGGATTTACTGTCTCTTGAAGTTCTTGATCCCAATGCTTCA
AAGCACAGAGCCAAGACTTCTACTTGAAACTGAAAGGAGAGTACTACTGTTACGTGGCTC
AGGTTGCTGCTGGTGATGACAAGAAAGGGATTATGCATCAGTCACAGCAAGCATACCAAG
AAGCTTTTCAAATCAGACATAGGAAATGCAAACAACACATCCTCTTGTACCGGATTTGGG
CTGTAAGTTCTCTGTGTCTATTGTATGAGTCTGAACTTCCCAGAGAAAGACTGCCCTCTT
GCAAGGATAGCTTTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKK-QQMAREYREKIETELRDICN-DVLSLLEKFLIPNASQ-AESKVFYLKMKGD
S.TEQGAELS.EER.L.SVAYKN..GA.RSSW....SIEQ....A.KK..QMA.EYRE..E..LRDIC..D.LSL....L.PNAS..A.S..FYLK.KG.
Retrocopy
SATEQGAELSKEERSL-SVAYKNLAGAHRSSWKIIPSIEQMRQDARKK/EQMA*EYREEMESDLRDICK\DLLSL--EVLDPNASK/AQSQDFYLKLKGE


Parental protein
YYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKK-EMQPTHPIRLGLALNFSV-FYYEILNSPEKACSLAKTAF
YY.Y.A.VAAGDDKKGI..QSQQAYQEAF.I....EMQ.THP....L...FSV..Y...LN.PEK.C.LA..AF
Retrocopy
YYCYVAQVAAGDDKKGIMHQSQQAYQEAFQIRHR/EMQTTHPLVPDLGCKFSV/VYCMSLNFPEKDCPLARIAF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide