RetrogeneDB ID:
retro_ecab_205
Organism:
Horse ( Equus_caballus )
Location:
10:3893660-3893955 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.84 %
Coverage:
64.1 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL24
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L24 [Source:HGNC Symbol;Acc:10325]

Genomic region (view in browser)





>retro_ecab_205
AAGGTGGAGCTGTGCAGTTCCAGCAGGTAGCAGTTCTGCCCCAACTGAGGAGGGGCCACA
CCAGGACCAATGGGAAGGTTTTCCAATTTTTTAATGCAAAATGCAAATCAGCCTTCAATT
CCAAGAGGAATACTCAGCAAACAAACTAAACTATCCTCTACAGAAGAAAGCACAAAAAGG
GACGGTCAGAAGAAATTTAAAAGAAAACCTGAGTGCAGTCAAATTCCAGAAGGCTGTCAC
TGGTGCATCTCTTGCTGATATAACAGCCAAGCGGAATCACAAAACTGAAATTAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.35
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RVELCSFSGYKIYPGHG-RRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYR-RKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPE
.VELCS.S.....P..G.R...RT.GKVFQF.NAKC.SAF.SKRN..Q.N.T.LYR..K..KG.......K....AVKFQ.A.TGASLADI.AKRN.K.E
Retrocopy
KVELCSSSR*QFCPN*G/RGHTRTNGKVFQFFNAKCKSAFNSKRNTQQTN*TILYR/KKAQKGTVRR-NLKENLSAVKFQKAVTGASLADITAKRNHKTE


Parental protein
VR
.R
Retrocopy
IR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide