RetrogeneDB ID:
retro_ecab_206
Organism:
Horse ( Equus_caballus )
Location:
10:4182194-4182553 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.04 %
Coverage:
99.19 %
Frameshifts:
6
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL31
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L31 [Source:HGNC Symbol;Acc:10334]

Genomic region (view in browser)





>retro_ecab_206
CTCCCCCAAAGAAGGGTGGGGAGAAGGGATCATTCTGCCATCAGAGAAGTGCAACCAGAG
TACCCCACCAACACCACAAGTGTACCCACAGAGTGAGCTCCAAGAGACAGGCCTCCTGGC
ATATTTCCAGACATCCGGACACTTGTCAGAAAGGAGTTGGGAACTTCAGATGTGCACATG
GACTTGGGCTCAACAGAGCTGTCTGGGCCAGAGGAACAGGGAACGTCCCATACCCTATCA
GTATATGGTTGTCCAGAAAGCACAACGAAGATGAAGATTCACCAAGAAACTCCACACATT
GTTACCTATATGCCTGTCACCACTTAAAAAACCTATGGACAGTCAACATGAACAAGAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LPLRRVARRRRAAAINEVVTREYTINI-HKRIHGVGFKKRA-PRALKEIRKFAMKEMGTPDVRIDTR-LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSP
LP.RRV.RR...A.I.EV...EY..N..HK..H.V..K..A.P.....IR....KE.GT.DV..D...LN.AVWA.G..NVPY.I...LSRK.NEDEDSP
Retrocopy
LPQRRVGRRDHSA-IREVQP-EYPTNT/HKCTHRVSSKRQA\PGIFPDIRTLVRKELGTSDVHMDLG/LNRAVWARGTGNVPYPISIWLSRKHNEDEDSP


Parental protein
-NKLYTL-VTYVPVTT-FKNLQTVNVDEN
..KL.TL.VTY.PVTT..KNL.TVN...N
Retrocopy
/KKLHTL/VTYMPVTT/LKNLWTVNMNKN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide