RetrogeneDB ID:
retro_ecab_211
Organism:
Horse ( Equus_caballus )
Location:
10:16468659-16468958 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
56.48 %
Coverage:
50.23 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
EBAG9
Parental gene aliases:
No gene alias available
Parental gene description:
estrogen receptor binding site associated, antigen, 9 [Source:HGNC Symbol;Acc:3123]

Genomic region (view in browser)





>retro_ecab_211
CAGAAAATCAGTATTGAGAAGAGTGAACCATTAAATTTTCACTAGTCAATTGGTAGCACA
GATTCTCTAGTAAATTAGCAGCTACATGAGATATTCTTTTTATGCATCCATCTCCAGAAT
TAGGTGACAGATGCACCCGGCAAGAAAATACCAATGCACGGGAAGAAGGTGTGGCCTGGC
GAGCAGAAGTTCTGTAGCAGCAGAAAGTAGCAGATGGAGAACAGAGAGCAGCAAAAAACA
GAAGAAAATGGAAAAGGAAGCTCAGGAGGAAGGAAAAAGGAACAATCGAAACTGACCTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.25
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QKIIIKKREPLNFGIPDGSTG-FSSRLAATQDMPFIHQSPELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKIADREKRAAEQQRKKMEKEAQRLMKKE
QKI.I.K.EPLNF....GST..FSS.LAAT.D..F.H.SPELGD..T.QENTNA...EE..AW.A.EVL.QQK.AD.E.RAA...RK...K....L..KE
Retrocopy
QKISIEKSEPLNFH*SIGSTD/FSSKLAAT*DILFMHPSPELGDRCTRQENTNA--REEGVAWRA-EVL*QQKVADGEQRAAKNRRKWKRK----LRRKE


Parental protein
QNKIGVKL
...I...L
Retrocopy
KGTIETDL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide