RetrogeneDB ID:
retro_ecab_213
Organism:
Horse ( Equus_caballus )
Location:
10:21966444-21967212 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.48 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_213
ATGGCTACCCAAAGGAAACACTTGGTAAAAGATTTCAATCCTTACATCACCTGCTATATC
TGTAAAGGGTATCTGATCAAGCCAACTACAGTGACCGAATGCCTCCATACCTTCTGTAAG
ACTTGTATTGTCCAGCACTTTGAAGATAGCAATGATTGTCCAAGGTGTGGCAACCAGGTT
CATGAGACCAATCCATTAGAAATGTTGAGGTTGGACAATACGTTAGAGGAAATCATATTT
AAACTGGTCCCTGGACTACGAGAACAAGAACTTGAGCGTGAATCTGAATTTTGGAAGAAA
AATAAGCCTCGAGAAAATGGACAAGATGATACTTCAAAAGTTGACAGACCTAAAGTTGAT
GAAGAAGGTGATGAAAATCAAGATGATAAAGACTATCACAGAAGTGACCCACAAATTGCT
ATATGTCTAGATTGTTTACGAAATAATGGACAATCAGGGGACAATGTAGTAAAGGGTTTA
ATGAAGAAATTCATTCGGTGTTCTACACGTGTAACTGTGGGAACTATTAAAAAATTTCTA
AGTTTAAAACTAAAACTTCCAAGTTCTTATGAGTTGGATGTGCTGTGCAATGGTGAAATT
ATGGGGAAGGATCATACTATGGAATTCATCTACATGACGAGGTGGCGACTAAGAGGCGAA
AACTTTCGGTGTCTGAACTGCTCAGCTTCGCAAGTCTGCTCTCAGGATGGCCCTTTATAT
CAGTCATACCCCATGGTATTGCAGTATCGACCGAGAATTGATTTTGGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.35
SRP021940_cerebellum 0.05
SRP021940_embryo 0.19
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.05
SRP021940_testis 1.48

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQLMTTPFFQLLRLDNTLEEIIFKLVPGLREQELERESEFWKK
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQ...T.....LRLDNTLEEIIFKLVPGLREQELERESEFWKK
Retrocopy
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKK


Parental protein
NKPQENGQDDTSKVDRPKVDEEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEI
NKP.ENGQDDTSKVDRPKVDEEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEI
Retrocopy
NKPRENGQDDTSKVDRPKVDEEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEI


Parental protein
MGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG
MGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG
Retrocopy
MGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide