RetrogeneDB ID:
retro_ecab_216
Organism:
Horse ( Equus_caballus )
Location:
10:38776000-38776488 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.36 %
Coverage:
68.72 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
RWDD1
Parental gene aliases:
No gene alias available
Parental gene description:
RWD domain containing 1 [Source:HGNC Symbol;Acc:20993]

Genomic region (view in browser)





>retro_ecab_216
CCCATACATGAAGTATTATCCCAGAAAAAAGAAGAAGATTTCTCAGACGTTTTAAAATTA
TTAATGTTACAAGAAGAGGAAAACGATATGTTAACAATCTTTGATTAAGTGTTGACTGTG
CAAGAAAAAGTAAATGAAAGAGTCAAACAAATAAAAATTATAAGAAAGAAAAAATGAAAA
AAAGAATGAAGGTAAGCAAAAGAAGCCAAAAAGCAATTAATCCATGGCATTTCTGTTACT
ATTGAGAATTTCTTAAGTTGGAAGGCAAAGTTTGATACAGAACTCTTGGAAATTAGAAAG
AAATAGATGAAGAAAGAAGAACAAGTAGGAAAAAAATTAGCTGAGGGGAAGCTATTTGAA
GCAGATGGTAATCTTGATGCACCTAGTATCCAATTCTTGGAGGATGGTGGGGACAACATG
GAGGTCAGTGAATCTTTGCTCCAGAAAATGGATGGCTCGAAGCTGAGGAGGAAGAGGACG
ATCCAGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLSWKAKFDAELLE
P..E..SQ......D.SD.LKLL.LQ.EEN..M..IF..V..VQEK.NE.V....................A.KQL.HG..VTIENFLSWKAKFD.ELLE
Retrocopy
PIHEVLSQK--KEEDFSDVLKLLMLQEEEN-DMLTIFD*VLTVQEKVNERVXXXXXXXXXXXXXXXXXXXXAKKQLIHGISVTIENFLSWKAKFDTELLE


Parental protein
IKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDD-LELEDDEDDPD
I.KK.MK.EEQ.GK....GK.LFE.D.NLD...IQFLED.G.N.EV.ESL.Q.MD..LE.E..EDDP.
Retrocopy
IRKK*MKKEEQVGKKLAEGK-LFEADGNLDAPSIQFLEDGGDNMEVSESLLQKMDG/LEAEEEEDDPE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide