RetrogeneDB ID:
retro_ecab_217
Organism:
Horse ( Equus_caballus )
Location:
10:45643605-45644196 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.68 %
Coverage:
60.84 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
AHSA2
Parental gene aliases:
No gene alias available
Parental gene description:
AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) [Source:HGNC Symbol;Acc:20437]

Genomic region (view in browser)





>retro_ecab_217
GCCAAGTGGGGCCAAGGGGACCTGCACTGGATCATGGAGTAGGAGAGCAGGTGTAACATG
AATAACTGGCACTGGACAAAGCAGATGTCACCAGCTGGTCCAAGGGGAAGCTCTGTGAGC
TCCTGATGGGCATCATTGTGGAGAGCAAGGCTGGCCACTGAGAGATCAGTGAGCTGAAGC
AGGAGGAAGCTTCCTGCAGTAGCCACAAAGGAAAGCCAATTTTCTTCTACAAGTGGAACA
TCAAACTAAGCTGGAAAAGTACAACTAAAGAATCTGGTGCAAAGCACAAGGGATTGATTG
AAACACCCAACTTTTCTGAAGAAAATGAAGTAGATGACACTGAGGTGAATATTAGCAAAA
AGAAAGGAGATAGGGATATACTGAAGGATCTTCCGTAAACTACAGGCACTGCCAAAGTCA
GGGAGGCCCTTGTAAATTACTAAAGGCACTTAAGACAGAATTTATGATGGGAATGATTTT
AGGGACAAAGCTATGGCAACCCAGGAATTGACTGTTAAAAGGAAACTGAGTGAGAACACC
ATGGCCTCATCTCCAGCAGCCTTGTGTGTAAGGGTTCCTACTGTGGCACTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AKWGQGDPRWIVEEREDGTNVNNWHWTER-DATSWSKGKLHELLVGIIVENEAGRCEISELKQVEGEASCSSRKGKLIFFYEWNIKLSWKGIIKESGVKH
AKWGQGD..WI.E..E...N.NNWHWT...D.TSWSKGKL.ELL.GIIVE..AG..EISELKQ.E..ASCSS.KGK.IFFY.WNIKLSWK...KESG.KH
Retrocopy
AKWGQGDLHWIME*-ESRCNMNNWHWTKQ/DVTSWSKGKLCELLMGIIVESKAGH*EISELKQEE--ASCSSHKGKPIFFYKWNIKLSWKSTTKESGAKH


Parental protein
KGLVEIPSLSEENEIDDTEVSVSKKKGDGDILKDLMKTAGTARVKEALGDY-LKALKTEFTMGMILPT-KAMATQELTVKRKLSVNPLQASSPVALGVRI
KGL.E.P..SEENE.DDTEV..SKKKGD.DILKDL..T.GTA.V.EAL..Y.LKALKTEF.MGMIL.T.KAMATQELTVKRKLS.N...ASSP.AL.VR.
Retrocopy
KGLIETPNFSEENEVDDTEVNISKKKGDRDILKDLP*TTGTAKVREALVNY/LKALKTEFMMGMILGT/KAMATQELTVKRKLSENTM-ASSPAALCVRV


Parental protein
PTVAV
PTVA.
Retrocopy
PTVAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide