RetrogeneDB ID:
retro_ecab_218
Organism:
Horse ( Equus_caballus )
Location:
10:51631489-51631931 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
88.67 %
Coverage:
98.67 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
GNB2L1
Parental gene aliases:
No gene alias available
Parental gene description:
guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 [Source:RefSeq peptide;Acc:NP_001229375]

Genomic region (view in browser)





>retro_ecab_218
ATCAAGCTATGGAATACTCTGGGTGTATACAAATATACTGTCCAGGATGAGAGCTACTCA
GAGTGGGTGTCTTGCATCTGCTTCTCACCAAACAGCAGTATTCCACCATTGTCTCCTGTG
GCCGGGACAAGTTGGTCAAGGTGTGGAATTTGGCAAACTGCAAGCTGAAGGCCAAACACA
TTGGCCACAGGGGCTACCTGAACACTGTCACTGTCTCTCCAGATGGATCTCTCTGTGCTT
CTGGAGGCAAGGATGGCCAGGCCATGCTTTGAGATTTAAATGAAGAAAAGCACCTTTATA
CACTAGATGGTGGGGACATCATCAACACCTTGTGCTTCAGTCCCAATCGCTACTGGCTCT
GTGCTGCCACAGGCCCCAGCATCAAGATCTGGGACTTGAAGGGCAAGATCATTGTAATGA
ACTGAAGCAAGAAGTTATCAGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNP-IIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHL
IKLWNTLGV.KYTVQDES.SEWVSC..FSPNSS.P..IVSCG.DKLVKVWNLANCKLK..HIGH.GYLNTVTVSPDGSLCASGGKDGQAML.DLNE.KHL
Retrocopy
IKLWNTLGVYKYTVQDESYSEWVSCICFSPNSSIP/TIVSCGRDKLVKVWNLANCKLKAKHIGHRGYLNTVTVSPDGSLCASGGKDGQAML*DLNEEKHL


Parental protein
YTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIV-DELKQEVIS
YTLDGGDIIN.LCFSPNRYWLCAATGPSIKIWDL.GKIIV..ELKQEVIS
Retrocopy
YTLDGGDIINTLCFSPNRYWLCAATGPSIKIWDLKGKIIV/NELKQEVIS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide