RetrogeneDB ID:
retro_ecab_22
Organism:
Horse ( Equus_caballus )
Location:
28:37442140-37443079 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.03 %
Coverage:
93.78 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_22
ATGGTGGATTACTATGAAGTTCTAGGAGTGCAGAGATACGCTTCACCTGAGGACATTAAA
AAGGCTTATTGTAAAGTGGCACTTAAATGGCATCCTGATAAAAATCCAGAAAATAAAGAA
GAAGCCGAGAGAAAATTCAAAGAAGTAGCTGAGGCATATGAGGTATTATCAAATGATAAA
AAACGGGACACTTATGATAAATATGGCAAAGAAGGATTAAATGGCAGAGTCAGAAGTCAT
TTTGATGATTCTTTTGAGTATGGCTTCACATTCCGTAAGCCAGATGATGTCTTTAAAGAA
ATTTTTGGTGAAAGGGATCCATTTTCATTTCATTTCTTTGAAGACTCACTTGAGGACCTT
TTAAACGGTCCAAGGAGCTGCTATGGAAGCAGAAACAGAGGTGGAAGATGCGTTTTCTCT
CCCTCCAGTGAATATTCAATTTTTGAGAGATTTTCTTCATGTGATACAGGATATACACCA
TATGGTTCACTGGGTCATGAGGGCCTTAATTCATTCTCTTCCCTGGCATTTGACGATAGT
GGGATGGGCAACTATGTATCTGTTACAACTTCAGGTAAAATTGTTAACGGCAGAAATACC
AATACAAAAAGAATTATTGAGAACGATCAAGAAAGAGAAGAAATTGAAGACAATGGCGAA
CTGAAGTCTTTCCTTATGAAGAGTGTGACAGGTGAAGAGGGCTTTGTGGAAGAATGCAGC
TGGAGAAGACAGTCATTCAACAAGTATTCACCAAAGTCCCACAGCCCAGAACATGTATGT
CAATACACTTTTGTGGACAATGATGAGCAAGCTATACCCTGGGTCACCAGCAACTGGGAT
CCCCTGATCTTCTCAGCAGGATTCAAAGAAGGTGGTAAGAGGAAAAAAAAGAAGCATAAA
GAGGTGCAGAAGAAGAAGTCAACCAAAAGGAATCGTTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.15
SRP021940_embryo 0.26
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.16
SRP021940_testis 20.89

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVDYYEVLGVQRHASAEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDLYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVF
MVDYYEVLGVQR.AS.EDIKKAY.K.ALKWHPDKNPENKEEAERKFK.VAEAYEVLS..KKRD.YDKYGKEGLN..G...SHFD..FE.GFTFR.PDDVF
Retrocopy
MVDYYEVLGVQRYASPEDIKKAYCKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDKKRDTYDKYGKEGLN--GRVRSHFDDSFEYGFTFRKPDDVF


Parental protein
REFFGGRDPFSFEFFEDPFEDFFGSRRGPRGSRNRGTGSFFSAFSGFPSFGGGFPSFDTGFTSFGSLGHGGLTSFSSTAFGGSGMGNFKSISTSTKTVNG
.E.FG.RDPFSF.FFED..ED.....R...GSRNRG....FS..S....F...F.S.DTG.T..GSLGH.GL.SFSS.AF..SGMGN..S..TS.K.VNG
Retrocopy
KEIFGERDPFSFHFFEDSLEDLLNGPRSCYGSRNRGGRCVFSPSSEYSIFER-FSSCDTGYTPYGSLGHEGLNSFSSLAFDDSGMGNYVSVTTSGKIVNG


Parental protein
RKITTKRIVENGQERVEVEEDGQLKS
R...TKRI.EN.QER.E.E..G.LKS
Retrocopy
RNTNTKRIIENDQEREEIEDNGELKS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide