RetrogeneDB ID:
retro_ecab_223
Organism:
Horse ( Equus_caballus )
Location:
10:62560328-62561624 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.34 %
Coverage:
95.79 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
TUBA1A
Parental gene aliases:
LOC100051840, TUBA1A
Parental gene description:
tubulin, alpha 1a [Source:HGNC Symbol;Acc:20766]

Genomic region (view in browser)





>retro_ecab_223
ATTGGCAATGCCTGCTAGGAGCTCTACTGCCTGGAGCACAGCATCCAGCCCCATGGCCAG
ATGCCAAGTGACAAGACCACTGGGGGAGGAGCTGATTCCTTCCACACCTTCTTCAGTGAG
ACTAGCGCTGGCAAGCATGTGCCTAGGGCAGTGTTTGTGGACCTGGAACCCACAGTCGTC
GATGAAGTTCACACTGGCATCTACCGCCAGCTCTTCCGCCATGAGCAGCTCAATACAGGC
AAGGAAGATGCTGCCAATAACTATGCCCATGGGCGCTACACCATTGACAAGGAGATCAGT
GACCTCATCTGAGACCAAATTTGGAAACTGGCCAACCAGTGCACAGAACTTTAGGGCTTC
TTGGTTTTTCACAGCTTTGGTGGGGGAACTGGTTCTGGGTTCGCCTCTCTGCCGATGGAA
GGTCTCTCTGTCGATTATGGCAGGTAGCTCAAGCTGGAGTTCTCCATTTACCCAGCCCCC
CAGGATTCCACAGCTGTAGTTGAGCCCTACAACTCCATCCTCACCACCCGTACCACCACG
GCGTACTCTGATTGTGCCTTCATGTAGACAATGAGGCCATCTATGACATCTGACATAGAA
ACCTCAATATTGAGTGCCCAATCTATACTAACTTGAATAAGTTGATAGGTCAAATTGTGT
CTTCCATCATTGCTTCCCTCAGATTTGATGAGCCCTGAATGTTGATCTGACAGAATTCCA
GATCAACCTCGTGTGCTCTCCCTGCATCCACTTCCCTCTGGCCACATATGCCCCTGTCAT
CTCTGTTGAGAAAGCCTACCATGAGCAGCTTTCTGTAGCAGAGATCACCAATGCTTGCTT
TGAGCCAGCCAACCAGATGGTGAAATGTGATTCATGCGATGGTAAATACATGGCTTGTTG
CTTGTTGTACTGTGGCAATGTGGTTCCCAAAGATGTCAACACTGCCATTTCCACCATCAA
GACCAAGCGTACCATCTAGTTGTGGATTGGTGCCCCACTGGCTTCAAAGTTGGCATTAAT
TCCCAGCTTCCCACTGTGGTACCTGGTGGAGACCTTGCCAAAGGGCAGCAAGCTGTGTGC
ACACTGAGCAATACCACAGCCACTGCTGAGGCCTGGGCTGGCCTGGACCGCAAGTTTGAC
CTGATGTATGCCAAGCGTGCCTTTGTTCACTGGTATGTGAACATGGAGGGCATGAAGGAA
GGAGAGTTTTCTGAAGCCCATGAGGACACGGCTGCCCTTGAGAAGGGTTATGAGAAGGTT
GGTGTGGATTCTGTTGACAGAGAGGGTGAGGAAGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.19
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEII
IGNAC.ELYCLEH.IQP.GQMPSDKT.GGG.DSF.TFFSET.AGKHVPRAVFVDLEPTV.DEV.TG.YRQLF..EQL.TGKEDAANNYA.G.YTI.KEI.
Retrocopy
IGNAC*ELYCLEHSIQPHGQMPSDKTTGGGADSFHTFFSETSAGKHVPRAVFVDLEPTVVDEVHTGIYRQLFRHEQLNTGKEDAANNYAHGRYTIDKEIS


Parental protein
DLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFM-VDNEAIYDICR
DL..D.I.KLA.QCT.L.GFLVFHSFGGGTGSGF.SL.ME.LSVDYG...KLEFSIYPAPQ.STAVVEPYNSILTT.TT...SDCAFM.VDNEAIYDI..
Retrocopy
DLI*DQIWKLANQCTEL*GFLVFHSFGGGTGSGFASLPMEGLSVDYGR*LKLEFSIYPAPQDSTAVVEPYNSILTTRTTTAYSDCAFM/VDNEAIYDI*H


Parental protein
RNLDIERPTYTNLNRLIGQIVSSITASLRFDG-ALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYM
RNL.IE.P.YTNLN.LIGQIVSSI.ASLRFD..ALNVDLTEFQ.NLV..P.IHFPLATYAPVIS.EKAYHEQLSVAEITNACFEPANQMVKCD...GKYM
Retrocopy
RNLNIECPIYTNLNKLIGQIVSSIIASLRFDE/ALNVDLTEFQINLVCSPCIHFPLATYAPVISVEKAYHEQLSVAEITNACFEPANQMVKCDSCDGKYM


Parental protein
ACCLLYRGDVVPKDVNAAIATIKTKRTI-QFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVG-E
ACCLLY.G.VVPKDVN.AI.TIKTKRTI...VDWCPTGFKVGIN.Q.PTVVPGGDLAK.Q.AVC.LSNTTA.AEAWA.LD.KFDLMYAKRAFVHWYV..E
Retrocopy
ACCLLYCGNVVPKDVNTAISTIKTKRTI/LVVDWCPTGFKVGINSQLPTVVPGGDLAKGQQAVCTLSNTTATAEAWAGLDRKFDLMYAKRAFVHWYVNME


Parental protein
GMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEE
GM.EGEFSEA.ED.AALEK.YE.VGVDSV..EGEEE
Retrocopy
GMKEGEFSEAHEDTAALEKGYEKVGVDSVDREGEEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide